KEGG   Homo sapiens (human): 57661
Entry
57661             CDS       T01001                                 
Symbol
PHRF1, PPP1R125, RNF221
Name
(RefSeq) PHD and ring finger domains 1
  KO
K17586  PHD and RING finger domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    57661 (PHRF1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     57661 (PHRF1)
SSDB
Motif
Pfam: PHD zf-RING_2 zf-C3HC4 zf-RING_UBOX zf-C3HC4_2 zf-C3HC4_3 zf-rbx1 zf-RING_5 PHD_2 zf-RING_10 zf-RING_11 zf-C3HC4_4
Other DBs
NCBI-GeneID: 57661
NCBI-ProteinID: NP_001273510
OMIM: 611780
HGNC: 24351
Ensembl: ENSG00000070047
Vega: OTTHUMG00000165141
Pharos: Q9P1Y6(Tbio)
UniProt: Q9P1Y6 A0A024RCA1
Position
11:576470..612222
AA seq 1649 aa
MDDDSLDELVARSPGPDGHPQVGPADPAGDFEESSVGSSGDSGDDSDSEHGDGTDGEDEG
ASEEEDLEDRSGSEDSEDDGETLLEVAGTQGKLEAAGSFNSDDDAESCPICLNAFRDQAV
GTPENCAHYFCLDCIVEWSKNANSCPVDRTLFKCICIRAQFGGKILRKIPVENTKASEEE
EDPTFCEVCGRSDREDRLLLCDGCDAGYHMECLDPPLQEVPVDEWFCPECAAPGVVLAAD
AGPVSEEEVSLLLADVVPTTSRLRPRAGRTRAIARTRQSERVRATVNRNRISTARRVQHT
PGRLGSSLLDEAIEAVATGLSTAVYQRPLTPRTPARRKRKTRRRKKVPGRKKTPSGPSAK
SKSSATRSKKRQHRVKKRRGKKVKSEATTRSRIARTLGLRRPVHSSCIPSVLKPVEPSLG
LLRADIGAASLSLFGDPYELDPFDSSEELSANPLSPLSAKRRALSRSALQSHQPVARPVS
VGLSRRRLPAAVPEPDLEEEPVPDLLGSILSGQSLLMLGSSDVIIHRDGSLSAKRAAPVS
FQRNSGSLSRGEEGFKGCLQPRALPSGSPAQGPSGNRPQSTGLSCQGRSRTPARTAGAPV
RLDLPAAPGAVQARNLSNGSVPGFRQSHSPWFNGTNKHTLPLASAASKISSRDSKPPCRS
VVPGPPLKPAPRRTDISELPRIPKIRRDDGGGRRDAAPAHGQSIEIPSACISRLTGREGT
GQPGRGTRAESEASSRVPREPGVHTGSSRPPAPSSHGSLAPLGPSRGKGVGSTFESFRIN
IPGNMAHSSQLSSPGFCNTFRPVDDKEQRKENPSPLFSIKKTKQLRSEVYDPSDPTGSDS
SAPGSSPERSGPGLLPSEITRTISINSPKAQTVQAVRCVTSYTVESIFGTEPEPPLGPSS
AMSKLRGAVAAEGASDTEREEPTESQGLAARLRRPSPPEPWDEEDGASCSTFFGSEERTV
TCVTVVEPEAPPSPDVLQAATHRVVELRPPSRSRSTSSSRSRKKAKRKRVSREHGRTRSG
TRSESRDRSSRSASPSVGEERPRRQRSKAKSRRSSSDRSSSRERAKRKKAKDKSREHRRG
PWGHSRRTSRSRSGSPGSSSYEHYESRKKKKRRSASRPRGRECSPTSSLERLCRHKHQRE
RSHERPDRKESVAWPRDRRKRRSRSPSSEHRAREHRRPRSREKWPQTRSHSPERKGAVRE
ASPAPLAQGEPGREDLPTRLPALGEAHVSPEVATADKAPLQAPPVLEVAAECEPDDLDLD
YGDSVEAGHVFDDFSSDAVFIQLDDMSSPPSPESTDSSPERDFPLKPALPPASLAVAAIQ
REVSLMHDEDPSQPPPLPEGTQEPHLLRPDAAEKAEAPSSPDVAPAGKEDSPSASGRVQE
AARPEEVVSQTPLLRSRALVKRVTWNLQESESSAPAEDRAPRAPLHRPQKPREGAWDMED
VAPTGVRQVFSELPFPSHVLPEPGFPDTDPSQVYSPGLPPAPAQPSSIPPCALVSQPTVQ
FILQGSLPLVGCGAAQTLAPVPAALTPASEPASQATAASNSEEKTPAPRLAAEKTKKEEY
MKKLHMQERAVEEVKLAIKPFYQKREVTKEEYKDILRKAVQKICHSKSGEINPVKVANLV
KAYVDKYRHMRRHKKPEAGEEPPTQGAEG
NT seq 4950 nt   +upstreamnt  +downstreamnt
atggatgacgacagcctggatgagcttgtggcccggagcccagggccggatggacaccca
caggtcggccctgcggacccggcaggtgactttgaagaaagcagcgtgggcagcagtggg
gactctggggacgacagtgacagcgagcatggagatggcacagacggagaagacgagggg
gcgtctgaggaggaagacctggaagacagatctggttccgaggattctgaagacgacggg
gagacattgctggaggtagcgggtactcaggggaaactggaagccgctggctctttcaat
tctgatgatgatgcagagagctgcccaatctgtctcaacgcattcagagaccaggccgtg
gggacgccggagaactgtgcccattacttctgcctggactgcattgtcgaatggtccaag
aatgccaattcctgtccagttgatcgaactctatttaagtgcatttgtattcgagctcaa
tttggtggtaaaatcttaagaaagatcccagtggagaacaccaaagcgagcgaggaggag
gaggacccgaccttctgtgaggtgtgcggcaggagcgaccgtgaggacaggcttttgctc
tgcgacggctgcgatgcggggtaccacatggaatgcttggacccccctctccaggaggtg
ccggtggacgagtggttctgcccggaatgtgctgcgcctggtgttgtccttgccgctgat
gcgggtcccgtgagtgaggaggaggtctccctgctcttggctgatgtggtgcccaccacc
agcaggcttcggcctcgagcaggtaggacccgggcgatagccaggacacggcagagtgag
agagtgagagcaaccgtgaaccggaaccggatctccacggccaggagggtccagcacaca
ccagggcgcctcgggtcttccctgctggatgaagccatcgaggctgtggcgactggcctg
agcactgccgtgtatcagcgccccctgacgccgcgcactcccgcccgacggaagaggaag
acaagaagacggaagaaagtgccgggaagaaagaaaaccccgtccggaccatccgcaaaa
agtaagagctcagcgacaagatctaagaaacgccaacatcgagtgaagaagagaagaggg
aagaaggtaaagagtgaagccaccactcgctctcgaatcgcgcggacgctgggcctgcgc
aggcctgttcacagcagctgcatcccgtcagtgttgaagccagtggagccctctttgggg
ctgctgagagcggatattggagctgcctctctgtctctgtttggagatccttatgagctg
gatcccttcgacagcagtgaagagctttctgcaaaccctctttcccctctgagtgccaag
agacgggctctgtcccggtcagccctgcagtcccaccagcccgtggccaggcccgtctcc
gtggggctttccaggaggcgcctccctgccgcggtgccagagccagacttggaggaggag
ccagtgcctgacctgctgggcagcatcctgtcgggccagagcctcctgatgctgggcagc
agtgatgtcatcatccaccgcgacggctccctcagcgccaagagggcggctccagtttct
tttcagcgaaactcaggcagtctgtccagaggggaagaaggattcaagggctgcctgcag
ccccgagcactgccctccgggagcccggcccaaggcccgtcaggaaacaggccacagagc
acagggctcagctgtcaaggcaggtcccgcacccccgcccgcaccgcgggggcgcctgtg
aggctggacttgccagcagcccctggggcggttcaggctcggaacttgtcaaatgggagt
gtgcctggcttcagacagagccacagcccctggttcaacggcaccaacaagcacaccttg
ccccttgcctctgccgcgtctaagatctcaagcagagattctaagcccccatgtcgcagt
gtggtgccggggcctcccctgaagccagcgcccagaagaacagacatctctgagctaccc
aggataccaaagatcaggagagatgacggtggtggcagacgggatgcggccccggcccac
gggcagagcattgagatccccagtgcctgcatcagccgactgactggcagggagggcacc
gggcagccagggcgaggcacacgggcagagagcgaggccagcagcagggtgccccgggag
cccggggtgcacacgggcagctcccggcccccagcccccagctcccatggcagtttggcc
ccactgggaccatcaagagggaaaggggtcgggtcgacctttgagagcttccggatcaat
attcctggaaacatggcacattccagccagctctccagccctggcttctgtaacacgttc
cggcctgtggacgataaggagcagaggaaggagaacccctcacccctcttctccatcaag
aagacgaagcagctgcggagcgaggtctacgacccatccgaccccaccggctccgactcc
agcgcccctggcagcagccccgagaggtctggccccggcctcctgccctctgagatcaca
cgaaccatctccatcaacagcccgaaggcccagacggtgcaggctgtgcgctgcgtcacc
tcctacacggtggagagcatctttggtacagagcccgaaccccctctcggaccgtcctcc
gccatgtccaagctccggggtgcagtggctgccgagggggcctctgacacggagcgagag
gagcccacagagagccagggcctggctgcccggctgcggaggccatcccccccagagccc
tgggatgaggaggatggggcgtcttgcagcaccttctttggctctgaggagcggacggtg
acctgtgtgactgtcgtggagccggaagccccacccagcccggacgtgctgcaggctgcc
acccacagagtcgtggagctcaggcccccttcccggtcccgctccacatccagctcccgc
agcaggaagaaggccaagaggaagagggtgtccagggagcacggacggacgcgctctggg
acgcgctctgaatccagggacaggagctcgaggtcagcgtcaccatcagtgggtgaggag
cgccccaggaggcagcggtccaaggccaagagccggcggtcctccagtgaccgctccagc
agccgagagcgagctaagaggaagaaagccaaggacaagagcagggagcacaggcggggc
ccctggggccacagccggaggacgtcccggtcgcggtcggggagccctggcagctcttcc
tatgagcactatgagagtaggaagaagaagaaaaggagatcagcgtccagacctcgggga
agggagtgctcccccaccagcagcctggagaggctctgcaggcacaagcatcagcgggaa
cgcagccacgagcggccagacaggaaggagagtgtggcgtggccccgagaccggaggaag
cggaggtcccggtccccaagctcggagcacagggcacgggagcacaggcggcctcggtcc
cgtgagaagtggccgcagacccggtcccattccccagagaggaagggggctgtgagggag
gcttccccagcgccccttgcacagggggagccagggcgggaagacctccccaccaggttg
ccagccttgggggaagcacatgtctcgccggaggtggctacggccgacaaggcccccctg
caggctccccctgtcctggaggtggcagctgagtgtgagccggacgacctggacctggat
tatggcgactccgtggaggccggacacgtctttgatgatttctcaagcgacgccgttttc
atccagctcgatgacatgagctcgccaccttctcccgaaagcacagactcttccccggag
cgagacttcccactgaagcctgcgttgcccccagccagcctggccgtggccgccatccag
agggaggtgtcattgatgcacgatgaagacccttcgcagcccccacccctgccagagggc
acccaggagccacatttgctcaggccggacgcggctgagaaggctgaggcacccagttcc
ccggatgtggcgcctgcggggaaggaagacagcccctctgcgagtgggagggtacaggag
gcagcccggcctgaggaggtggtttcgcagacccccctgctgcggtccagagccctggtg
aagcgggtcacctggaacctgcaggagtcggagagcagcgcccccgccgaggacagagcc
ccccgggcaccacttcacaggccacagaagccccgagaaggagcctgggacatggaggat
gtggcccccacaggggtcaggcaggtgttctccgagctgccctttcccagtcacgtgctt
ccggaacccgggttcccagacacagacccctctcaggtttacagccccggcctgccgcct
gccccggcccagccctcaagcatcccaccctgcgcactggtcagccagcccacggtccag
ttcatccttcaggggagcctgccgctagtgggctgtggggcagcacagaccctggcccca
gtgcccgctgccctgaccccagcctcagagccagccagtcaagccactgcagccagcaac
tcggaggagaagaccccggcccccaggctagctgcggagaaaaccaagaaggaggagtac
atgaagaagctgcacatgcaggagcgtgctgtggaggaggtgaagctggccatcaagccc
ttctaccagaagagggaggtgaccaaggaggagtacaaggacatcctgcgcaaggccgtg
cagaagatctgccacagcaagagtggagagatcaaccccgtgaaggtggccaacctggtg
aaggcgtacgtggacaagtacaggcacatgcgcaggcacaagaaaccagaggccggggag
gagccgcccacgcagggggccgagggctga

DBGET integrated database retrieval system