KEGG   Homo sapiens (human): 57662
Entry
57662             CDS       T01001                                 
Symbol
CAMSAP3, KIAA1543, NEZHA, PPP1R80
Name
(RefSeq) calmodulin regulated spectrin associated protein family member 3
  KO
K17493  calmodulin-regulated spectrin-associated protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    57662 (CAMSAP3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    57662 (CAMSAP3)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     57662 (CAMSAP3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     57662 (CAMSAP3)
  Intermediate filaments
   Intermediate filament-binding proteins
    57662 (CAMSAP3)
SSDB
Motif
Pfam: CAMSAP_CKK CAMSAP_CH CAMSAP_CC1
Other DBs
NCBI-GeneID: 57662
NCBI-ProteinID: NP_065953
OMIM: 612685
HGNC: 29307
Ensembl: ENSG00000076826
Pharos: Q9P1Y5(Tbio)
UniProt: Q9P1Y5
Position
19:7595863..7618304
AA seq 1249 aa
MVEAAPPGPGPLRRTFLVPEIKSLDQYDFSRAKAAASLAWVLRAAFGGAEHVPPELWEPF
YTDQYAQEHVKPPVTRLLLSAELYCRAWRQALPQLETPPNPSALLALLARRGTVPALPER
PVREADLRHQPILMGAHLAVIDALMAAFAFEWTKTLPGPLALTSLEHKLLFWVDTTVRRL
QEKTEQEAAQRASPAAPADGAAPAQPSIRYRKDRVVARRAPCFPTVTSLQDLASGAALAA
TIHCYCPQLLRLEEVCLKDPMSVADSLYNLQLVQDFCASRLPRGCPLSLEDLLYVPPPLK
VNLVVMLAELFMCFEVLKPDFVQVKDLPDGHAASPRGTEASPPQNNSGSSSPVFTFRHPL
LSSGGPQSPLRGSTGSLKSSPSMSHMEALGKAWNRQLSRPLSQAVSFSTPFGLDSDVDVV
MGDPVLLRSVSSDSLGPPRPAPARTPTQPPPEPGDLPTIEEALQIIHSAEPRLLPDGAAD
GSFYLHSPEGPSKPSLASPYLPEGTSKPLSDRPTKAPVYMPHPETPSKPSPCLVGEASKP
PAPSEGSPKAVASSPAATNSEVKMTSFAERKKQLVKAEAEAGAGSPTSTPAPPEALSSEM
SELSARLEEKRRAIEAQKRRIEAIFAKHRQRLGKSAFLQVQPREASGEAEAEAEEADSGP
VPGGERPAGEGQGEPTSRPKAVTFSPDLGPVPHEGLGEYNRAVSKLSAALSSLQRDMQRL
TDQQQRLLAPPEAPGSAPPPAAWVIPGPTTGPKAASPSPARRVPATRRSPGPGPSQSPRS
PKHTRPAELRLAPLTRVLTPPHDVDSLPHLRKFSPSQVPVQTRSSILLAEETPPEEPAAR
PGLIEIPLGSLADPAAEDEGDGSPAGAEDSLEEEASSEGEPRVGLGFFYKDEDKPEDEMA
QKRASLLERQQRRAEEARRRKQWQEVEKEQRREEAARLAQEEAPGPAPLVSAVPMATPAP
AARAPAEEEVGPRKGDFTRQEYERRAQLKLMDDLDKVLRPRAAGSGGPGRGGRRATRPRS
GCCDDSALARSPARGLLGSRLSKIYSQSTLSLSTVANEAHNNLGVKRPTSRAPSPSGLMS
PSRLPGSRERDWENGSNASSPASVPEYTGPRLYKEPSAKSNKFIIHNALSHCCLAGKVNE
PQKNRILEEIEKSKANHFLILFRDSSCQFRALYTLSGETEELSRLAGYGPRTVTPAMVEG
IYKYNSDRKRFTQIPAKTMSMSVDAFTIQGHLWQGKKPTTPKKGGGTPK
NT seq 3750 nt   +upstreamnt  +downstreamnt
atggtggaggcggcgccccccgggcccgggccgctgcggaggacctttctagtgcccgag
atcaagtcgctggaccagtacgatttctcgcgggccaaggcggcggccagcctggcgtgg
gtgctgcgggccgcgttcgggggcgcagagcacgtgcccccggagctgtgggagcccttc
tataccgaccagtacgcgcaggagcatgtgaagcccccggtgacacggctgctgctctca
gccgagctctactgcagagcctggcgccaggcactgccacagcttgaaacaccccccaac
ccctctgcactgctggccctgctggcgcggaggggcacagtgcctgctttgcccgagcgc
ccggtgcgcgaggccgacctgaggcaccagcccattctcatgggagcccacctagctgtc
attgatgccctcatggctgcctttgccttcgagtggacaaagaccctgccaggtcccttg
gccctgaccagcttggagcacaagctgcttttctgggtggacacgaccgtccggcggctg
caggagaagaccgagcaggaagcggcccagcgagcctctccagcagcccctgcagacggg
gcggccccggcgcagccctcgatccgataccgcaaggaccgtgtggtggcgcgacgtgcc
ccctgcttcccgacggtgaccagcctccaggacctggccagtggggccgcgctggccgcc
accatccactgctattgtccccagctgcttcgacttgaggaggtgtgcttgaaggacccc
atgtctgtggcggacagcctgtacaacctccagctcgtgcaggatttctgtgcctctcgc
cttcctcgtggctgccccctgtcccttgaggacttgctgtacgtcccaccgccactcaag
gtcaacttggtggtgatgctggccgagttgttcatgtgttttgaggtgctcaagcccgac
tttgtgcaagtgaaggacttgcccgatggtcacgctgcctccccccggggcactgaggcc
tccccacctcagaacaacagcggcagtagttctcctgtcttcaccttccgccacccgctt
ctgtcatctggtggcccccagtccccactccgaggatccacaggctccctgaagtcttcc
ccgtccatgtcccatatggaggccctgggcaaggcctggaaccggcagctcagccgtccc
ctctcccaggctgtgtcattcagcaccccctttggcctggacagcgacgtggatgtcgtc
atgggagaccctgtgctcctccgctctgtgagctcggacagcctgggccccccgcgtccc
gcgccggccaggacccccacccagccacccccggagcctggtgacctgcccaccatcgag
gaagctctgcagatcatccacagtgccgagccccggctcctcccagatggggcggccgac
ggcagcttctacctccactcccctgaggggccctccaagccatccctggcctccccctac
ctgcccgaggggacctccaaaccactgtccgacaggcccaccaaagcaccagtgtacatg
ccacaccccgagaccccctcgaaaccatctccctgtctggtgggggaggcatcgaaaccg
ccagccccatccgaggggtccccgaaggcggtggcttcgtccccagcagccaccaactcc
gaggtgaaaatgaccagctttgcagaacgcaagaaacagctggtgaaggcagaggctgag
gccggagcggggtcccccacgtccactccggccccgccggaggccctgagctcggagatg
agtgagctcagcgcccggctggaggagaaacgcagagccatcgaggctcagaagcgacgg
attgaggccatattcgccaagcaccgccagcggctgggcaaaagcgccttcctgcaggtg
cagccgcgggaagcctctggggaggcggaagcagaggcggaggaggccgattccggtcca
gtccctggtggggagcggcccgcaggcgagggccagggtgagccaacctcacggcccaag
gcagtgaccttctcgccagacctgggcccggtgccccacgaggggctgggggaatacaat
cgagcggtcagcaagctgagtgccgccttgagctcgctgcagcgggacatgcagaggctc
acggaccagcagcagcggctcctggccccgcccgaggcccccggatccgccccaccacct
gctgcgtgggtcatccctggccccacgacggggcccaaagctgcatcccccagccccgcc
cggcgagtcccggccacccggcgcagccctgggcccgggcccagccagtcaccccgcagc
ccgaaacacacgcggccagcggagctgcggctggcacccttgaccagggtgcttacgcca
ccccacgacgtagacagcctcccccacctgcgcaagttctcgccgagccaggtgcccgtg
cagacgcgctcttccatcctcctggcggaggagacgccccccgaggagccagccgcccgg
ccgggcctcatcgagatcccgctgggcagcctggcagatcccgccgccgaggacgaggga
gacgggagccccgctggtgctgaggattccttggaggaggaggcgtcttcggagggggag
ccccgggtggggctggggttcttctacaaggatgaagacaagcctgaggacgagatggcc
caaaagcgggccagcctgctggagcggcagcagcggcgagcagaggaggcgcggcggcgc
aagcagtggcaggaggtggagaaggaacagcggagggaggaggccgcgaggctggcccaa
gaggaggccccgggcccagccccgcttgtgtccgcagtcccgatggcgactccagcccct
gctgcccgggctccagccgaggaggaggtgggcccccggaagggggacttcacgcggcag
gagtacgagcgccgggcccagctgaagctgatggacgacctcgataaggtgctgcggccc
cgggctgcggggtccgggggtccaggtcggggcgggcggagggccacccggcctcgctcg
ggttgctgtgacgactcagccctggcacgaagcccagcccgcggcctgctgggctctcgg
ctgagcaaaatctattcccagtccaccctgtcactgtccactgtggccaacgaggcccac
aataacctcggggtgaagaggcccacgtctcgggctccctccccgtcaggtctcatgtcc
ccaagccgcctgcctggaagccgcgaacgggactgggaaaatggcagcaatgcctcctcc
ccagcgtcagtgcccgagtacacaggtccacggctgtacaaagaacccagcgccaagtcc
aacaagttcatcatccacaatgccctatcacactgctgcctggcgggcaaggtgaacgaa
ccgcagaagaatcgcattctggaggaaattgagaaaagcaaggccaaccacttcctgatc
ctctttcgcgactcgagctgccagttccgggcgctctacacgctgtcgggggagacagag
gagctgtcgcggctggcagggtatgggccccggaccgtcacgcccgccatggtggaaggc
atctacaagtacaactcggaccgcaagcgcttcacccagatccccgccaagaccatgtcc
atgagcgtcgatgccttcaccatccagggacacctctggcagggcaagaaacccaccact
cccaagaagggcggcggcacccccaaatag

DBGET integrated database retrieval system