KEGG   Homo sapiens (human): 57670Help
Entry
57670             CDS       T01001                                 

Definition
(RefSeq) KIAA1549
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3827 SKG6
Motif
Other DBs
NCBI-GeneID: 57670
NCBI-ProteinID: NP_001158137
OMIM: 613344
HGNC: 22219
Ensembl: ENSG00000122778
Vega: OTTHUMG00000157214
UniProt: Q9HCM3
Position
7q34
AA seq 1950 aa AA seqDB search
MPGARRRRRGAAMEGKPRAGVALAPGPSGRRPSARCARRRRPGLLLPGLWLLLLARPASC
APDELSPEQHNLSLYSMELVLKKSTGHSAAQVALTETAPGSQHSSPLHVTAPPSATTFDT
AFFNQGKQTKSTADPSIFVATYVSVTSKEVAVNDDEMDNFLPDTHWTTPRMVSPIQYITV
SPPGLPREALEPMLTPSLPMVSLQDEEVTSGWQNTTRQPAAYAESASHFHTFRSAFRTSE
GIVPTPGRNLVLYPTDAYSHLSSRTLPEIVASLTEGVETTLFLSSRSLMPQPLGDGITIP
LPSLGEVSQPPEEVWATSADRYTDVTTVLSQSLEETISPRTYPTVTASHAALAFSRTHSP
LLSTPLAFASSASPTDVSSNPFLPSDSSKTSELHSNSALPGPVDNTHILSPVSSFRPYTW
CAACTVPSPQQVLATSLMEKDVGSGDGAETLCMTVLEESSISLMSSVVADFSEFEEDPQV
FNTLFPSRPIVPLSSRSMEISETSVGISAEVDMSSVTTTQVPPAHGRLSVPASLDPTAGS
LSVAETQVTPSSVTTAFFSVITSILLDSSFSVIANKNTPSLAVRDPSVFTPYSLVPSVES
SLFSDQERSSFSEHKPRGALDFASSFFSTPPLELSGSISSPSEAPASLSLMPSDLSPFTS
QSFSPLVETFTLFDSSDLQSSQLSLPSSTNLEFSQLQPSSELPLNTIMLLPSRSEVSPWS
SFPSDSLEFVEASTVSLTDSEAHFTSAFIETTSYLESSLISHESAVTALVPPGSESFDIL
TAGIQATSPLTTVHTTPILTESSLFSTLTPPDDQISALDGHVSVLASFSKAIPTGTVLIT
DAYLPSGSSFVSEATPFPLPTELTVVGPSLTPTEVPLNTSTEVSTTSTGAATGGPLDSTL
MGDAASQSPPESSAAPPLPSLRPVTAFTLEATVDTPTLATAKPPYVCDITVPDAYLITTV
LARRAVQEYIITAIKEVLRIHFNRAVELKVYELFTDFTFLVTSGPFVYTAISVINVLINS
KLVRDQTPLILSVKPSFLVPESRFQVQTVLQFVPPSVDTGFCNFTQRIEKGLMTALFEVR
KHHQGTYNLTVQILNITISSSRVTPRRGPVNIIFAVKSTQGFLNGSEVSELLRNLSVVEF
SFYLGYPVLQIAEPFQYPQLNLSQLLKSSWVRTVLLGVMEKQLQNEVFQAEMERKLAQLL
SEVSTRRRMWRRATVAAGNSVVQVVNVSRLEGDDNPVQLIYFVEDQDGERLSAVKSSDLI
NKMDLQRAAIILGYRIQGVIAQPVDRVKRPSPESQSNNLWVIVGVVIPVLVVMVIVVILY
WKLCRTDKLDFQPDTVANIQQRQKLQIPSVKGFDFAKQHLGQHNKDDILIIHEPAPLPGP
LKDHTTPSENGDVPSPKSKIPSKNVRHRGRVSPSDADSTVSEESSERDAGDKTPGAVNDG
RSHRAPQSGPPLPSSGNEQHSSASIFEHVDRISRPPEASRRVPSKIQLIAMQPIPAPPVQ
RPSPADRVAESNKINKEIQTALRHKSEIEHHRNKIRLRAKRRGHYEFPVVDDLSSGDTKE
RHRVYRRAQMQIDKILDPTASVPSVFIEPRKSSRIKRSPKPRRKHQVNGCPADAEKDRLI
TTDSDGTYRRPPGVHNSAYIGCPSDPDLPADVQTPSSVELGRYPALPFPASQYIPPQPSI
EEARQTMHSLLDDAFALVAPSSQPASTAGVGPGVPPGLPANSTPSQEERRATQWGSFYSP
AQTANNPCSRYEDYGMTPPTGPLPRPGFGPGLLQSTELVPPDPQQPQASAEAPFAARGIY
SEEMPSVARPRPVGGTTGSQIQHLTQVGIASRIGAQPVEIPPSRGSQYGGPGWPSYGEDE
AGRREATHMLGHQEYSSSPLFQVPRTSGREPSAPSGNLPHRGLQGPGLGYPTSSTEDLQP
GHSSASLIKAIREELLRLSQKQSTVQNFHS
NT seq 5853 nt NT seq  +upstreamnt  +downstreamnt
atgccgggggcgcggcgccgacgccgaggcgcggccatggaggggaagccccgcgccggg
gtcgcgctggccccggggccgagcggccgacggccttccgcccgctgcgcccgccgccgc
cgcccggggctgctgcttcctggcctctggctgctgctgctggcccggccggcctcgtgc
gccccagatgagctctctccggaacagcacaacctttctttatactccatggagctcgtg
ctgaagaaaagcactgggcacagcgctgcacaagtggccttaacagaaactgctcccggc
tcccagcacagcagtcctctccatgtcacagccccgccgtctgccactacttttgataca
gccttttttaaccaaggaaaacagaccaaaagtacagcagatcccagcatctttgtggca
acttacgtgtcagtgacgagtaaagaggtggccgtcaatgacgatgagatggataacttt
ctgccagatactcactggaccactccacggatggtttctccaatacagtatatcacagtc
agcccaccagggctgcccagggaagcattagaacctatgctcactccatcattacccatg
gtttctttacaagatgaagaagtgacatcgggctggcagaacacaacgcgacaaccagcg
gcatatgctgagtccgccagtcatttccacacctttcggtcagcttttcgcacctctgag
ggcatcgttccaactcctggcaggaatttggtgctttatcctactgatgcttacagtcat
ttatcaagcaggactctgccagagattgtggcttccctaacagagggtgtggaaaccacc
ctttttttaagctcccggtctttaatgccacagccgttaggcgacggcattactataccg
ttgccctccttgggggaggtctcacagcctccagaggaggtttgggccacaagtgcagac
agatacactgatgtgaccactgtgttgagtcaaagcctagaagaaaccatctctccaaga
acataccccactgtgactgcatcgcacgcagcccttgcattcagcaggacacattctcca
ttgctttcaactcctcttgcatttgcgtcctctgcttcaccaactgatgtttcatctaac
ccctttctccctagcgactccagcaaaacatccgaattgcatagcaattcagccctcccc
ggtcctgtggacaacactcatatcctgagcccggtgtcctcattcagaccatacacttgg
tgtgcggcctgcactgtgccttcacctcagcaagttctggccacgagcctcatggagaaa
gacgtgggatcaggggatggtgccgagactctgtgcatgaccgtgctggaagaaagcagc
atctctctaatgagtagcgtcgtagcagacttctctgaatttgaggaagatcctcaagta
tttaatacgcttttcccctccagacctatcgtcccactttcttctagatccatggaaatc
tcagagacgagtgttggcatttctgccgaggtggatatgagtagtgttacaaccacacag
gttccccctgcccacggccgcctctctgtgccggcgtcacttgatcctactgctggctcc
ttgtctgttgctgaaacccaagtgacgccatccagcgtgaccactgcatttttctcggtc
atcaccagcattctccttgactcatctttctctgtcatagcaaacaaaaacacaccgtcg
cttgccgtcagagacccgagtgtttttacgccttatagtctggttccttcagtggagtct
tcacttttctctgaccaagaacgttccagtttttctgagcataaacccagaggtgctttg
gattttgcatccagctttttctcaacacccccgctggaactcagcggctccatctcttcg
ccttcggaagcacctgcgtctctgtctctgatgccgagtgacttgtcccccttcacatct
cagtctttttctcccttggttgagacatttacattgtttgactctagtgatctgcagtca
tctcagctgtctcttcccagttccacaaatcttgagttttcgcagctccagccaagttcc
gagctgcctttaaacaccatcatgttgctacctagccgttctgaggtgtcaccatggtca
agcttcccttctgattctctcgagtttgttgaagcgtctacggtttcactgacggattca
gaagctcattttacctcagctttcattgaaactacctcctatcttgagtcttcactcatt
tcccatgaatccgcagtcactgcactggtgccccccggctctgagtcttttgacattttg
actgccgggattcaagcaacatcaccattgaccactgtccacacaacgcccattttaact
gagtcttctttgttctcaactctgacacctcctgacgaccaaatcagtgctctagacggt
cacgtgtctgtcctggcctctttctccaaagccattcccactggtacggtgttgatcact
gacgcgtacctgccatcaggatcctcgtttgtttctgaagcaacccccttccctctgccc
acagagctgaccgtcgtgggcccatcactcacacccacagaggtgccactgaacacctcc
acggaagtgagcacaaccagcaccggtgctgccactggtggtcccctcgactccaccctg
atgggtgacgccgcaagtcagagccccccagagagtagtgctgctcctcccctgccatcc
ctgcgtcccgtgactgccttcactctcgaagcaacagtcgacacaccaacactggctact
gccaagccgccatatgtttgtgatatcacagtccccgatgcctatctgatcacaactgtg
ctggccagaagagctgtgcaggagtacatcattacagcaatcaaagaagtactgaggatt
cacttcaaccgtgcagtggaactgaaggtttacgaactatttactgacttcacttttctg
gtaacatccggtcctttcgtttacacggcaatatccgtcataaatgtgcttataaacagt
aagcttgtccgtgaccagactcctttaatcctgtctgtgaaaccttctttccttgtgcca
gagtccaggttccaagttcaaacagtacttcagtttgtgcctccgagtgtggatactggc
ttctgcaacttcacccagcgcattgagaaaggcctaatgacagctctctttgaagtgaga
aaacaccaccagggaacgtataacctcacggtgcagatcttgaatatcaccatcagttcc
tcaagggtgactcctcggcggggcccggtgaatatcatctttgcggttaaaagcacacag
ggatttttgaatgggtcggaagtgagcgagctgctcagaaacttgagtgtggtggagttc
agtttctatctgggatacccagtgctgcagatcgcagagcccttccagtatccacagctc
aacttatctcagttgctgaagtcctcttgggtcagaacagttctcctgggcgtcatggag
aagcaactccagaatgaagtgtttcaagccgagatggaacgcaagctggcccagctgctc
agcgaggtttccaccagaaggcggatgtggagaagggccactgtagctgcagggaacagt
gtggtgcaggtggtaaatgtgtcgaggctggagggagatgacaatccggtacagctcatc
tactttgtggaggatcaagatggagaaagactcagtgcagtcaagtcttcggacctgatt
aacaaaatggacctccagagagcagccatcatcttgggttaccgaattcaaggtgtcatt
gcccagcctgtcgacagggtgaagaggccgtctccggaatcccagagcaacaacttgtgg
gtcattgttggcgtggtcatcccagtgctggtggtgatggtgattgttgtcatcctctac
tggaaactatgccgcacagacaagctagactttcagcctgacactgtggccaacattcag
cagcgtcagaagctgcagatccctagtgtgaagggcttcgattttgctaagcagcatctg
ggtcagcacaataaagacgacatattgattattcatgagccagcgccactgccaggacct
ctgaaggaccacaccacgccctcggaaaatggagacgtgccaagccccaagtcaaagatc
ccttccaagaatgttcgtcacagaggaagagtttctccctcagatgctgactctacggtc
agtgaagagtccagcgagagggacgcaggagataagacgccgggagccgtcaacgatggc
aggtcccacagagctccgcagagcgggccaccactgcccagttcgggaaatgagcagcac
tcatcagcctccatcttcgagcacgtggacaggatctcccgccccccggaggctagccgg
cgggtccccagtaagatccagcttatcgccatgcagccgatcccggcacctcccgtccag
cgcccctccccagccgaccgagtggcggaaagcaataaaatcaacaaagagattcagacc
gcgctgcggcacaagtctgagatcgagcaccatcgcaacaagatccgcctgcgcgccaag
cgccgcgggcactacgagttcccggtggtagacgacctgtcctcgggcgacactaaggag
cgacaccgggtgtaccgcagggcacagatgcagatcgacaagatcctggaccccacggcc
agcgtgccctccgtgttcatagagcccaggaagagctcacggataaaacgttctcccaag
cctcgccggaaacaccaggtcaacggctgtcctgccgacgctgagaaggaccggctcatc
accacagacagcgatggcacctacaggaggccccccggcgtccacaactcagcctacatc
ggatgcccatcggatcctgacctcccagccgatgtgcagacaccatcctcggtggaactg
gggaggtatccagcccttcccttcccggcctcccagtacatcccaccccagccgtccatc
gaggaggcacgccagaccatgcactccctcctggacgacgcctttgccctcgtggccccc
agcagccagcctgccagcaccgcaggtgtaggccccggagtcccacccggcctgcccgca
aacagcaccccttcccaggaagagaggcgagccacccagtgggggtccttctacagccca
gcccagacggccaacaatccctgcagtagatacgaagactatggaatgactcccccgacg
ggtccattgccaagaccaggttttggccccggtttgctgcagtctacagagctggtgccc
cctgaccctcagcagccacaggcctccgccgaagccccatttgctgccagagggatctac
tcggaggagatgccgtcggtggcccggcctcggcctgtcgggggtaccacaggctcccag
atccagcacctgacacaggtggggattgccagcagaattggagctcagccagtggaaatc
ccgccaagcagaggcagccagtatggggggccaggctggccttcgtacggggaggacgaa
gcggggcgaagagaggccacacacatgctcggacatcaagagtattcttcttcaccgcta
tttcaggtgccaaggacttcaggcagggagccctcagctccttccgggaacctcccccac
cggggactgcagggccctgggctgggttaccccaccagctccacggaagacctccagcct
ggccactcctcggcctctctcatcaaagcaatccgcgaggagctcctccggctctcccag
aaacagagcaccgtgcagaacttccacagctga

DBGET integrated database retrieval system