KEGG   Homo sapiens (human): 57687Help
Entry
57687             CDS       T01001                                 

Gene name
VAT1L
Definition
(RefSeq) vesicle amine transport 1 like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_N ADH_zinc_N
Motif
Other DBs
NCBI-GeneID: 57687
NCBI-ProteinID: NP_065978
HGNC: 29315
Ensembl: ENSG00000171724
Vega: OTTHUMG00000176845
Pharos: Q9HCJ6(Tdark)
UniProt: Q9HCJ6 A8K288
Structure
PDB: 

Position
16q23.1
AA seq 419 aa AA seqDB search
MAKEGVEKAEETEQMIEKEAGKEPAEGGGGDGSHRLGDAQEMRAVVLAGFGGLNKLRLFR
KAMPEPQDGELKIRVKACGLNFIDLMVRQGNIDNPPKTPLVPGFECSGIVEALGDSVKGY
EIGDRVMAFVNYNAWAEVVCTPVEFVYKIPDDMSFSEAAAFPMNFVTAYVMLFEVANLRE
GMSVLVHSAGGGVGQAVAQLCSTVPNVTVFGTASTFKHEAIKDSVTHLFDRNADYVQEVK
RISAEGVDIVLDCLCGDNTGKGLSLLKPLGTYILYGSSNMVTGETKSFFSFAKSWWQVEK
VNPIKLYEENKVIAGFSLLNLLFKQGRAGLIRGVVEKLIGLYNQKKIKPVVDSLWALEEV
KEAMQRIHDRGNIGKLILDVEKTPTPLMANDSTETSEAGEEEEDHEGDSENKERMPFIQ
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaggcgtggagaaggcggaggagacggagcaaatgatcgagaaggaggca
ggcaaggagccggcggagggcggcggcggcgacggctcgcaccgcctcggggacgcccag
gagatgcgcgcggtggtgctggctggcttcggggggctcaacaagctgcggctcttcagg
aaggccatgcccgagcctcaggacggcgagctcaagatccgcgtcaaagcctgtggatta
aacttcattgacttgatggtgcgacaagggaatattgacaaccctcccaagactcccctg
gtgccaggatttgagtgttctgggattgttgaagctctgggggacagcgtgaaaggatat
gagattggagaccgtgtcatggcatttgtcaattacaatgcctgggcagaggtggtctgc
acaccagtggagtttgtctacaagatcccggatgacatgagcttctccgaggctgctgca
ttccccatgaacttcgtcacagcctatgtgatgctgtttgaagttgccaacctccgggaa
gggatgtctgtgctcgtgcactcagctggtgggggcgtgggtcaagctgtggctcagctg
tgttccactgtccccaacgtgactgtctttggaacagcctctactttcaagcatgaagca
atcaaagactctgtgacccacctctttgacagaaatgcagactacgtgcaagaagttaaa
agaatctctgctgaaggtgtggacatcgttttggattgcctctgtggggacaacactgga
aaaggtctcagtcttctcaaacccctgggaacctacattttatatggctcatccaacatg
gtaactggagagaccaagagcttcttcagctttgcaaaatcatggtggcaggtggagaag
gtgaaccccatcaagctgtatgaggagaacaaagtcatcgcggggttttcccttttaaat
ctgctcttcaaacaaggccgggcgggcctcattcggggagtggtggaaaaactcataggg
ctctacaaccagaagaagatcaagcctgtggtggactccttgtgggctctggaggaggtg
aaggaggccatgcagcggattcacgaccgagggaacattggcaagttaattctggatgta
gaaaagaccccaactccactgatggccaatgacagcacagagaccagtgaagcaggggaa
gaggaggaggaccacgagggagacagcgagaacaaggagcggatgccctttatccagtaa

DBGET integrated database retrieval system