KEGG   Homo sapiens (human): 57689
Entry
57689             CDS       T01001                                 

Symbol
LRRC4C, NGL-1, NGL1
Name
(RefSeq) leucine rich repeat containing 4C
  KO
K07523  netrin-G1 ligand
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    57689 (LRRC4C)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    57689 (LRRC4C)
SSDB
Motif
Pfam: LRR_8 LRR_5 LRR_4 I-set Ig_3 ig V-set LRR_9 Ig_2 Ig_6 LRR_1 LRRNT Insulin_TMD Syndecan
Other DBs
NCBI-GeneID: 57689
NCBI-ProteinID: NP_001245348
OMIM: 608817
HGNC: 29317
Ensembl: ENSG00000148948
Vega: OTTHUMG00000166383
Pharos: Q9HCJ2(Tbio)
UniProt: Q9HCJ2 Q4JIW0 Q4JIV9
Structure
PDB: 
3ZYJ

Position
11p12
AA seq 640 aa
MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKV
ICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAF
NGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLG
ELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQ
GLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHH
NPWNCNCDILWLSWWIKDMAPSNTACCARCNTPPNLKGRYIGELDQNYFTCYAPVIVEPP
ADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQD
TGMYTCMVSNSVGNTTASATLNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTP
VVDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMA
AVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNS
YKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgttgaacaagatgaccttacatccacagcagataatgataggtcctaggtttaacagg
gccctatttgaccccctgcttgtggtgctgctggctcttcaacttcttgtggtggctggt
ctggtgcgggctcagacctgcccttctgtgtgctcctgcagcaaccagttcagcaaggtg
atttgtgttcggaaaaacctgcgtgaggttccggatggcatctccaccaacacacggctg
ctgaacctccatgagaaccaaatccagatcatcaaagtgaacagcttcaagcacttgaga
cacttggaaatcctacagttgagtaggaaccatatcagaaccattgaaattggggctttc
aatggtctggcgaacctcaacactctggaactctttgacaatcgtcttactaccatcccg
aatggagcttttgtatacttgtctaaactgaaggagctctggttgcgaaacaaccccatt
gaaagcatcccttcttatgcttttaacagaattccttctttgcgccgactagacttaggg
gaattgaaaagactttcatacatctcagaaggtgcctttgaaggtctgtccaacttgagg
tatttgaaccttgccatgtgcaaccttcgggaaatccctaacctcacaccgctcataaaa
ctagatgagctggatctttctgggaatcatttatctgccatcaggcctggctctttccag
ggtttgatgcaccttcaaaaactgtggatgatacagtcccagattcaagtgattgaacgg
aatgcctttgacaaccttcagtcactagtggagatcaacctggcacacaataatctaaca
ttactgcctcatgacctcttcactcccttgcatcatctagagcggatacatttacatcac
aacccttggaactgtaactgtgacatactgtggctcagctggtggataaaagacatggcc
ccctcgaacacagcttgttgtgcccggtgtaacactcctcccaatctaaaggggaggtac
attggagagctcgaccagaattacttcacatgctatgctccggtgattgtggagccccct
gcagacctcaatgtcactgaaggcatggcagctgagctgaaatgtcgggcctccacatcc
ctgacatctgtatcttggattactccaaatggaacagtcatgacacatggggcgtacaaa
gtgcggatagctgtgctcagtgatggtacgttaaatttcacaaatgtaactgtgcaagat
acaggcatgtacacatgtatggtgagtaattccgttgggaatactactgcttcagccacc
ctgaatgttactgcagcaaccactactcctttctcttacttttcaaccgtcacagtagag
actatggaaccgtctcaggatgaggcacggaccacagataacaatgtgggtcccactcca
gtggtcgactgggagaccaccaatgtgaccacctctctcacaccacagagcacaaggtcg
acagagaaaaccttcaccatcccagtgactgatataaacagtgggatcccaggaattgat
gaggtcatgaagactaccaaaatcatcattgggtgttttgtggccatcacactcatggct
gcagtgatgctggtcattttctacaagatgaggaagcagcaccatcggcaaaaccatcac
gccccaacaaggactgttgaaattattaatgtggatgatgagattacgggagacacaccc
atggaaagccacctgcccatgcctgctatcgagcatgagcacctaaatcactataactca
tacaaatctcccttcaaccacacaacaacagttaacacaataaattcaatacacagttca
gtgcatgaaccgttattgatccgaatgaactctaaagacaatgtacaagagactcaaatc
taa

DBGET integrated database retrieval system