KEGG   Homo sapiens (human): 57689Help
Entry
57689             CDS       T01001                                 

Gene name
LRRC4C, NGL-1, NGL1
Definition
(RefSeq) leucine rich repeat containing 4C
  KO
K07523  netrin-G1 ligand
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    57689 (LRRC4C)
 Organismal Systems
  Development
   04360 Axon guidance
    57689 (LRRC4C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_5 LRR_4 I-set Ig_3 ig LRR_9 V-set Ig_2 LRRNT Podoplanin
Motif
Other DBs
NCBI-GeneID: 57689
NCBI-ProteinID: NP_001245348
OMIM: 608817
HGNC: 29317
Ensembl: ENSG00000148948
Vega: OTTHUMG00000166383
Pharos: Q9HCJ2(Tbio)
UniProt: Q9HCJ2 Q4JIV9 Q4JIW0
Structure
PDB: 

Position
11p12
AA seq 640 aa AA seqDB search
MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKV
ICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAF
NGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLG
ELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQ
GLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHH
NPWNCNCDILWLSWWIKDMAPSNTACCARCNTPPNLKGRYIGELDQNYFTCYAPVIVEPP
ADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQD
TGMYTCMVSNSVGNTTASATLNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTP
VVDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMA
AVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNS
YKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacaagatgaccttacatccacagcagataatgataggtcctaggtttaacagg
gccctatttgaccccctgcttgtggtgctgctggctcttcaacttcttgtggtggctggt
ctggtgcgggctcagacctgcccttctgtgtgctcctgcagcaaccagttcagcaaggtg
atttgtgttcggaaaaacctgcgtgaggttccggatggcatctccaccaacacacggctg
ctgaacctccatgagaaccaaatccagatcatcaaagtgaacagcttcaagcacttgaga
cacttggaaatcctacagttgagtaggaaccatatcagaaccattgaaattggggctttc
aatggtctggcgaacctcaacactctggaactctttgacaatcgtcttactaccatcccg
aatggagcttttgtatacttgtctaaactgaaggagctctggttgcgaaacaaccccatt
gaaagcatcccttcttatgcttttaacagaattccttctttgcgccgactagacttaggg
gaattgaaaagactttcatacatctcagaaggtgcctttgaaggtctgtccaacttgagg
tatttgaaccttgccatgtgcaaccttcgggaaatccctaacctcacaccgctcataaaa
ctagatgagctggatctttctgggaatcatttatctgccatcaggcctggctctttccag
ggtttgatgcaccttcaaaaactgtggatgatacagtcccagattcaagtgattgaacgg
aatgcctttgacaaccttcagtcactagtggagatcaacctggcacacaataatctaaca
ttactgcctcatgacctcttcactcccttgcatcatctagagcggatacatttacatcac
aacccttggaactgtaactgtgacatactgtggctcagctggtggataaaagacatggcc
ccctcgaacacagcttgttgtgcccggtgtaacactcctcccaatctaaaggggaggtac
attggagagctcgaccagaattacttcacatgctatgctccggtgattgtggagccccct
gcagacctcaatgtcactgaaggcatggcagctgagctgaaatgtcgggcctccacatcc
ctgacatctgtatcttggattactccaaatggaacagtcatgacacatggggcgtacaaa
gtgcggatagctgtgctcagtgatggtacgttaaatttcacaaatgtaactgtgcaagat
acaggcatgtacacatgtatggtgagtaattccgttgggaatactactgcttcagccacc
ctgaatgttactgcagcaaccactactcctttctcttacttttcaaccgtcacagtagag
actatggaaccgtctcaggatgaggcacggaccacagataacaatgtgggtcccactcca
gtggtcgactgggagaccaccaatgtgaccacctctctcacaccacagagcacaaggtcg
acagagaaaaccttcaccatcccagtgactgatataaacagtgggatcccaggaattgat
gaggtcatgaagactaccaaaatcatcattgggtgttttgtggccatcacactcatggct
gcagtgatgctggtcattttctacaagatgaggaagcagcaccatcggcaaaaccatcac
gccccaacaaggactgttgaaattattaatgtggatgatgagattacgggagacacaccc
atggaaagccacctgcccatgcctgctatcgagcatgagcacctaaatcactataactca
tacaaatctcccttcaaccacacaacaacagttaacacaataaattcaatacacagttca
gtgcatgaaccgttattgatccgaatgaactctaaagacaatgtacaagagactcaaatc
taa

DBGET integrated database retrieval system