KEGG   Homo sapiens (human): 5770Help
Entry
5770              CDS       T01001                                 

Gene name
PTPN1, PTP1B
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 1
  KO
K05696  tyrosine-protein phosphatase non-receptor type 1 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04520  Adherens junction
hsa04910  Insulin signaling pathway
hsa04931  Insulin resistance
Drug target
Ertiprotafib: D04050
Trodusquemine: D06252
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    5770 (PTPN1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5770 (PTPN1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    5770 (PTPN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5770 (PTPN1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5770 (PTPN1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    5770 (PTPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase DSPc Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 5770
NCBI-ProteinID: NP_002818
OMIM: 176885
HGNC: 9642
Ensembl: ENSG00000196396
Vega: OTTHUMG00000032729
Pharos: P18031(Tchem)
UniProt: P18031 A8K3M3
Structure
PDB: 

Position
20q13.13
AA seq 435 aa AA seqDB search
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE
PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYG
IESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT
AGAYLCYRFLFNSNT
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggagatggaaaaggagttcgagcagatcgacaagtccgggagctgggcggccatttac
caggatatccgacatgaagccagtgacttcccatgtagagtggccaagcttcctaagaac
aaaaaccgaaataggtacagagacgtcagtccctttgaccatagtcggattaaactacat
caagaagataatgactatatcaacgctagtttgataaaaatggaagaagcccaaaggagt
tacattcttacccagggccctttgcctaacacatgcggtcacttttgggagatggtgtgg
gagcagaaaagcaggggtgtcgtcatgctcaacagagtgatggagaaaggttcgttaaaa
tgcgcacaatactggccacaaaaagaagaaaaagagatgatctttgaagacacaaatttg
aaattaacattgatctctgaagatatcaagtcatattatacagtgcgacagctagaattg
gaaaaccttacaacccaagaaactcgagagatcttacatttccactataccacatggcct
gactttggagtccctgaatcaccagcctcattcttgaactttcttttcaaagtccgagag
tcagggtcactcagcccggagcacgggcccgttgtggtgcactgcagtgcaggcatcggc
aggtctggaaccttctgtctggctgatacctgcctcttgctgatggacaagaggaaagac
ccttcttccgttgatatcaagaaagtgctgttagaaatgaggaagtttcggatggggctg
atccagacagccgaccagctgcgcttctcctacctggctgtgatcgaaggtgccaaattc
atcatgggggactcttccgtgcaggatcagtggaaggagctttcccacgaggacctggag
cccccacccgagcatatccccccacctccccggccacccaaacgaatcctggagccacac
aatgggaaatgcagggagttcttcccaaatcaccagtgggtgaaggaagagacccaggag
gataaagactgccccatcaaggaagaaaaaggaagccccttaaatgccgcaccctacggc
atcgaaagcatgagtcaagacactgaagttagaagtcgggtcgtggggggaagtcttcga
ggtgcccaggctgcctccccagccaaaggggagccgtcactgcccgagaaggacgaggac
catgcactgagttactggaagcccttcctggtcaacatgtgcgtggctacggtcctcacg
gccggcgcttacctctgctacaggttcctgttcaacagcaacacatag

DBGET integrated database retrieval system