KEGG   Homo sapiens (human): 5770Help
Entry
5770              CDS       T01001                                 

Gene name
PTPN1, PTP1B
Definition
(RefSeq) protein tyrosine phosphatase non-receptor type 1
  KO
K05696  tyrosine-protein phosphatase non-receptor type 1 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04520  Adherens junction
hsa04910  Insulin signaling pathway
hsa04931  Insulin resistance
Drug target
Ertiprotafib: D04050
Trodusquemine: D06252
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    5770 (PTPN1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5770 (PTPN1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    5770 (PTPN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5770 (PTPN1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5770 (PTPN1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    5770 (PTPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase DSPc Y_phosphatase3 TUDOR_5 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 5770
NCBI-ProteinID: NP_002818
OMIM: 176885
HGNC: 9642
Ensembl: ENSG00000196396
Vega: OTTHUMG00000032729
Pharos: P18031(Tchem)
UniProt: P18031 A8K3M3
Structure
PDB: 
2CM2 5QGF 5QGB 2F71 5QDK 5QF3 5QFE 5QDQ 5QFH 5QFK 5QGC 3CWE 1PA1 5QEF 5QFU 5QDI 5QFQ 5QFR 5QG8 5QFV 5QEL 5QEZ 5QFG 5QG3 5QGA 5QFW 5QGD 5QDU 5QEC 5QEX 5QG9 5QDH 5QFI 5QFN 5QE1 5QE9 5QFD 5QFF 5QGE 3SME 3A5J 2CMB 2F6T 2F6V 2F6Z 5QDF 5QE7 5QF0 5QEO 5QET 5QEV 5QFZ 5QEB 5QER 5QF5 5QG6 5QDP 5QE3 5QEA 5QEI 5QEU 5QFA 6B8X 4ZRT 5QDS 5QEM 5QES 5QF7 5QG0 5QDE 5QDJ 5QED 5QDV 5QE5 5QE6 5QEP 5QF2 5QF6 5QFP 5QFY 5QDR 5QEN 5QEY 5QDG 5QDO 5QE2 5QG4 6B8Z 2VEV 2CNE 2CNH 1G7F 1C88 1C83 1EEO 5QE8 5QG7 5QDN 5QDT 5QFL 5QFX 6B8E 5QDL 5QEW 5QF4 5QFM 5QDY 5QF1 5QFC 5KA1 5QE4 5QFB 5QFO 5QFS 6B8T 3A5K 1PTY 5QEK 5K9V 5KAC 5KAD 4Y14 4QAP 3EAX 2CNG 1T49 1EEN 1AAX 4QBW 5QEJ 5QEE 5QEH 5QF9 5QFJ 6BAI 6B95 6B90 1SUG 1ECV 5QFT 5QEG 5QEQ 5KA8 5KAA 5KAB 5QE0 6CWV 5QF8 5KA0 2VEW 2HB1 2CNI 2F6F 2AZR 1G1F 5K9W 3QKP 6PM8 5QDX 5KA7 4BJO 5QG5 5KA2 5KA9 6CWU 6PG0 6OMY 6OLV 6OLQ 5T19 2ZN7 2ZMM 2QBQ 2QBS 2NT7 2NTA 2CM3 2CM7 2CM8 2FJM 2B07 1Q6N 1I57 1C87 1BZH 5QG2 2F70 6PHS 1GFY 5QDZ 5KA3 2F6Y 1PXH 1OEO 1ONY 5KA4 6PGT 3QKQ 2VEX 2VEY 2CNF 2CMC 2FJN 2F6W 1WAX 1T48 1Q6J 1Q6M 1Q6S 1PYN 1PH0 1OES 1OEV 1JF7 1G7G 1G1G 5QDW 5QG1 3I80 1BZJ 4QBE 6PHA 3I7Z 3D9C 2QBR 2H4K 2CMA 2B4S 1QXK 1Q6P 1Q6T 1OET 1C86 1PTV 6PFW 1KAV 1C84 1BZC 4QAH 3EB1 2VEU 2BGD 1ONZ 1NZ7 1NWL 1NO6 1NNY 1NL9 1G1H 4I8N 2QBP 2H4G 1XBO 1OEU 1LQF 1L8G 1KAK 1A5Y 1Q1M 1PTU 3ZMP 5QDM 3EU0 1T4J 1C85 3ZV2 2HNQ 2HNP 1PTT 1NWE 3ZMQ 2BGE 1OEM
Thumbnails

Position
20q13.13
AA seq 435 aa AA seqDB search
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE
PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYG
IESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT
AGAYLCYRFLFNSNT
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggagatggaaaaggagttcgagcagatcgacaagtccgggagctgggcggccatttac
caggatatccgacatgaagccagtgacttcccatgtagagtggccaagcttcctaagaac
aaaaaccgaaataggtacagagacgtcagtccctttgaccatagtcggattaaactacat
caagaagataatgactatatcaacgctagtttgataaaaatggaagaagcccaaaggagt
tacattcttacccagggccctttgcctaacacatgcggtcacttttgggagatggtgtgg
gagcagaaaagcaggggtgtcgtcatgctcaacagagtgatggagaaaggttcgttaaaa
tgcgcacaatactggccacaaaaagaagaaaaagagatgatctttgaagacacaaatttg
aaattaacattgatctctgaagatatcaagtcatattatacagtgcgacagctagaattg
gaaaaccttacaacccaagaaactcgagagatcttacatttccactataccacatggcct
gactttggagtccctgaatcaccagcctcattcttgaactttcttttcaaagtccgagag
tcagggtcactcagcccggagcacgggcccgttgtggtgcactgcagtgcaggcatcggc
aggtctggaaccttctgtctggctgatacctgcctcttgctgatggacaagaggaaagac
ccttcttccgttgatatcaagaaagtgctgttagaaatgaggaagtttcggatggggctg
atccagacagccgaccagctgcgcttctcctacctggctgtgatcgaaggtgccaaattc
atcatgggggactcttccgtgcaggatcagtggaaggagctttcccacgaggacctggag
cccccacccgagcatatccccccacctccccggccacccaaacgaatcctggagccacac
aatgggaaatgcagggagttcttcccaaatcaccagtgggtgaaggaagagacccaggag
gataaagactgccccatcaaggaagaaaaaggaagccccttaaatgccgcaccctacggc
atcgaaagcatgagtcaagacactgaagttagaagtcgggtcgtggggggaagtcttcga
ggtgcccaggctgcctccccagccaaaggggagccgtcactgcccgagaaggacgaggac
catgcactgagttactggaagcccttcctggtcaacatgtgcgtggctacggtcctcacg
gccggcgcttacctctgctacaggttcctgttcaacagcaacacatag

DBGET integrated database retrieval system