KEGG   Homo sapiens (human): 57700
Entry
57700             CDS       T01001                                 

Gene name
FAM160B1, KIAA1600, bA106M7.3
Definition
(RefSeq) family with sequence similarity 160 member B1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: RAI16-like
Other DBs
NCBI-GeneID: 57700
NCBI-ProteinID: NP_065991
OMIM: 617312
HGNC: 29320
Ensembl: ENSG00000151553
Vega: OTTHUMG00000019092
Pharos: Q5W0V3(Tdark)
UniProt: Q5W0V3
Position
10q25.3
AA seq 765 aa
MFSKFTSILQHAVEALAPSLPLQEDFVYHWKAITHYYIETSDDKAPVTDTNIPSHLEQML
DILVQEENERESGETGPCMEYLLHHKILETLYTLGKADCPPGMKQQVLVFYTKLLGRIRQ
PLLPHINVHRPVQKLIRLCGEVLATPTENEEIQFLCIVCAKLKQDPYLVNFFLENKMKSL
ASKGVPNVISEDTLKGQDSLSTDTGQSRQPEELSGATGMEQTELEDEPPHQMDHLSTSLD
NLSVTSLPEASVVCPNQDYNLVNSLLNLTRSPDGRIAVKACEGLMLLVSLPEPAAAKCLT
QSTCLCELLTDRLASLYKALPQSVDPLDIETVEAINWGLDSYSHKEDASAFPGKRALISF
LSWFDYCDQLIKEAQKTAAVALAKAVHERFFIGVMEPQLMQTSEMGILTSTALLHRIVRQ
VTSDVLLQEMVFFILGEQREPETLAEISRHPLRHRLIEHCDHISDEISIMTLRMFEHLLQ
KPNEHILYNLVLRNLEERNYTEYKPLCPEDKDVVENGLIAGAVDLEEDPLFTDISPENTL
PNQEWLSSSPPATPDHPKNDGKTEVHKIVNSFLCLVPDDAKSSYHVEGTGYDTYLRDAHR
QFRDYCAICLRWEWPGSPKALEKCNLEAAFFEGHFLKVLFDRMGRILDQPYDVNLQVTSV
LSRLSLFPHPHIHEYLLDPYVNLAPGCRSLFSVIVRVVGDLMLRIQRIQDFTPKLLLVRK
RLLGLEPEGPIIDHITLLEGVIVLEEFCKELAAIAFVKYHASSTP
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgttctccaagttcacctccatcctgcagcacgccgtggaggcgcttgcaccttctctt
cctttacaagaagattttgtttatcactggaaggcaattacccattactacatagagact
tcagatgataaagccccagtgaccgatacaaatattccatcgcatctggaacagatgtta
gatatactggttcaagaagaaaatgaacgggaatctggagagacagggccatgtatggaa
tatttgcttcatcacaagatcttggaaacattatataccttggggaaagctgattgtcct
ccgggaatgaaacagcaggttttggttttctatacgaaacttctgggaagaatccggcag
ccactacttccacacattaacgtgcacaggccagtgcagaaattaattagactctgtggt
gaagtcctagcaacaccaacagaaaatgaagagattcagtttctttgcattgtgtgtgcg
aagctgaaacaggacccctacctggttaactttttcctagagaataagatgaaatcattg
gcttccaaaggagtaccaaatgtaatttcagaagatacattaaaaggtcaggattccttg
tcaacagatacaggacagtcccgtcaaccagaggaactatctggtgctactggaatggag
caaacagaattggaagatgagcctcctcatcagatggatcacctgtccacaagcttggat
aacctcagtgtcacctcactgccagaggcctcggttgtttgtccaaatcaggattacaat
ttagtgaattctttgttaaatcttactagaagtcctgatggcagaatagctgtgaaggca
tgtgaaggcttgatgctgttagtaagtttgccagagcctgcggctgcaaagtgccttaca
cagagcacttgcttgtgtgaactactgacagacagacttgcctccctgtacaaggcccta
cctcagtcagtggatccgttagatattgaaaccgtggaagcaattaactggggcttggac
tcatatagtcataaagaagatgcttcagcatttccaggaaaacgagccttaatttcattt
ctttcctggtttgattattgtgatcagctcattaaggaagcccaaaagactgctgctgtt
gctcttgccaaagctgttcatgaaagatttttcattggtgttatggaacctcaattaatg
caaacttctgagatgggtattctcacatccactgctctgcttcatcgcatcgttcggcaa
gtgacctctgatgttttgcttcaagaaatggtgttttttatccttggagaacagagggaa
ccagaaactctggcagaaatcagcagacatcctttaaggcataggttaattgaacattgt
gatcacatatctgatgagataagcataatgacattacgaatgtttgaacatcttttacaa
aaacccaatgagcacattctttacaacttggtcttgagaaatcttgaagaaagaaattat
acagaatataaacctttgtgcccagaagataaagatgtggtagaaaatggattgatagca
ggagcagtagatctggaagaagatccattatttactgacatttcaccagaaaacactttg
ccaaaccaagagtggcttagttcttcacctcctgctactccagaccaccccaaaaatgat
ggaaaaactgaagttcataaaattgtaaatagttttctctgtctggtaccggatgacgca
aaatcctcctaccatgttgagggcacaggatatgacacttacctccgagacgctcatagg
cagttccgagactactgtgctatctgcttaagatgggagtggcctgggtctccaaaagca
ttggaaaagtgcaatttagaagctgctttctttgaaggtcattttttgaaagtgctgttc
gacagaatgggaagaattcttgatcagccatatgatgtaaacttacaagtaacctcagtg
ttatctagactttctctcttccctcatccacacatccacgagtaccttttggatccttac
gtgaacctcgctcctggctgtagatctctcttctctgtaattgtcagggttgttggagac
cttatgcttcgaatccagcgtattcaagactttactcccaagcttctgttagtcagaaag
cggttacttggtttggaacctgaaggccctattattgaccacatcacactgctagagggt
gtgattgtgttagaagagttctgtaaggagctggcggcaatcgcatttgtaaaatatcat
gcttcctccacaccataa

DBGET integrated database retrieval system