KEGG   Homo sapiens (human): 57703
Entry
57703             CDS       T01001                                 
Symbol
CWC22, EIF4GL, NCM, fSAPb
Name
(RefSeq) CWC22 spliceosome associated protein homolog
  KO
K13100  pre-mRNA-splicing factor CWC22
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    57703 (CWC22)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    57703 (CWC22)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    57703 (CWC22)
SSDB
Motif
Pfam: MA3 Cnd1
Other DBs
NCBI-GeneID: 57703
NCBI-ProteinID: NP_065994
OMIM: 615186
HGNC: 29322
Ensembl: ENSG00000163510
Pharos: Q9HCG8(Tbio)
UniProt: Q9HCG8
Structure
Position
2:complement(179944876..180007297)
AA seq 908 aa
MKSSVAQIKPSSGHDRRENLNSYQRNSSPEDRYEEQERSPRDRDYFDYSRSDYEHSRRGR
SYDSSMESRNRDREKRRERERDTDRKRSRKSPSPGRRNPETSVTQSSSAQDEPATKKKKD
ELDPLLTRTGGAYIPPAKLRMMQEQITDKNSLAYQRMSWEALKKSINGLINKVNISNISI
IIQELLQENIVRGRGLLSRSVLQAQSASPIFTHVYAALVAIINSKFPQIGELILKRLILN
FRKGYRRNDKQLCLTASKFVAHLINQNVAHEVLCLEMLTLLLERPTDDSVEVAIGFLKEC
GLKLTQVSPRGINAIFERLRNILHESEIDKRVQYMIEVMFAVRKDGFKDHPIILEGLDLV
EEDDQFTHMLPLEDDYNPEDVLNVFKMDPNFMENEEKYKAIKKEILDEGDTDSNTDQDAG
SSEEDEEEEEEEGEEDEEGQKVTIHDKTEINLVSFRRTIYLAIQSSLDFEECAHKLLKME
FPESQTKELCNMILDCCAQQRTYEKFFGLLAGRFCMLKKEYMESFEGIFKEQYDTIHRLE
TNKLRNVAKMFAHLLYTDSLPWSVLECIKLSEETTTSSSRIFVKIFFQELCEYMGLPKLN
ARLKDETLQPFFEGLLPRDNPRNTRFAINFFTSIGLGGLTDELREHLKNTPKVIVAQKPD
VEQNKSSPSSSSSASSSSESDSSDSDSDSSDSSSESSSEESDSSSISSHSSASANDVRKK
GHGKTRSKEVDKLIRNQQTNDRKQKERRQEHGHQETRTERERRSEKHRDQNSSGSNWRDP
ITKYTSDKDVPSERNNYSRVANDRDQEMHIDLENKHGDPKKKRGERRNSFSENEKHTHRI
KDSENFRRKDRSKSKEMNRKHSGSRSDEDRYQNGAERRWEKSSRYSEQSRESKKNQDRRR
EKSPAKQK
NT seq 2727 nt   +upstreamnt  +downstreamnt
atgaaaagtagtgtggcacagataaaaccttcttctggtcatgacagaagggaaaacctt
aattcatatcagaggaactcctctccagaagacagatatgaagaacaagaacgatccccc
cgggatagagattactttgattacagcagatcagactatgagcattcaagaagaggacgt
tcttatgatagtagcatggagtcacgaaacagggaccgagaaaaacgcagagaaagagaa
agagatacggatcggaaaaggtctcggaaatccccatctcctgggaggagaaacccagaa
acatcagtaactcagagttcctctgctcaggatgaacctgctacaaagaaaaagaaagat
gagctggatcctcttcttactcgcactggtggagcatatattccccctgcaaagctcagg
atgatgcaggaacagattacagataaaaacagcttagcataccagaggatgagttgggag
gccctgaagaagtcaattaatggccttatcaacaaagtcaacatttccaacataagtatt
attattcaagagcttcttcaagaaaatatagttagaggaagaggactgctgtccaggtct
gttttgcaagcacagagtgcttctccaatcttcacccatgtttatgcagcattagtggca
attatcaactcaaaatttccacaaattggagaattaatcctcaaaaggttaattcttaat
tttcgaaaaggctatcgaagaaatgacaagcaactttgcctgactgcttcaaaatttgtg
gcgcatcttattaaccaaaatgtggcacacgaagtattatgcttagagatgctcactttg
ctcctggaaagaccaacagatgatagcgttgaagtagctattggttttcttaaggaatgt
ggcctcaaattaacacaagtgtcaccaagaggaatcaatgctatatttgaacgccttcga
aacattctgcatgagtctgaaattgacaaaagagttcaatatatgattgaagtgatgttt
gctgtacggaaagatggattcaaggaccaccccattatcctagaaggtcttgatttggtg
gaagaagatgatcaattcactcatatgctccctctggaggatgactataatccagaagat
gttcttaatgttttcaagatggatcctaattttatggagaatgaagagaagtacaaagct
attaagaaagaaattcttgatgagggagatactgactcgaacacagaccaggatgctggg
agtagtgaagaggacgaggaagaagaagaggaagagggagaagaagatgaagaaggacaa
aaagtaactattcatgacaaaacagaaattaacctggtctcatttcgtcgtacaatttat
cttgctattcagtcaagtttagattttgaagaatgtgctcacaaattgctgaaaatggag
tttcctgaaagccaaacaaaagaactctgcaacatgatacttgattgctgtgcccaacag
aggacatacgaaaaattttttggcttattagctgggcgattttgcatgctaaagaaagag
tacatggaatcctttgaaggtatattcaaagaacagtatgataccatccatcgcttggaa
acaaacaagttgcgaaatgttgctaagatgtttgctcaccttttatacactgattcactt
ccatggagtgttcttgaatgtataaaactgagtgaagaaaccactacatcatccagtaga
atttttgtcaaaatatttttccaggaactgtgtgaatacatgggtcttcctaaacttaat
gcaagattaaaggatgaaactctgcagccattctttgaaggattattaccccgagataat
ccaagaaacactcggtttgccatcaacttctttacttctataggtcttggaggtttaacg
gatgaactgcgggagcatctcaaaaatacaccaaaggtcattgtggcgcagaaaccagat
gttgagcaaaataaatcctccccatcctcttcctcttcagcgtcctcctcttcagagtct
gactcatccgactctgattctgacagcagtgatagcagttcagagtcttccagtgaagag
agcgactcttcatccatcagtagtcatagctctgcctcagctaatgatgtaagaaagaag
ggacatgggaagaccagaagtaaagaggtagataaattgatcagaaaccagcaaacaaat
gataggaaacaaaaagaaagaagacaagaacacgggcaccaggaaacaaggactgagaga
gaaagaaggtcagaaaaacacagagatcaaaattcaagtggttcaaattggagagatcct
ataacaaagtacacatcagacaaagatgttccttctgaacgaaataactacagtagagtt
gcgaatgacagagaccaagaaatgcatatagatttggaaaataagcatggtgatcccaaa
aagaagagaggagagagaagaaattctttttctgaaaatgagaagcatacacaccgaatt
aaagacagtgaaaatttcagaagaaaagatagatcaaagtcaaaggaaatgaatagaaag
cactcaggctcaagaagtgatgaagatagatatcaaaatggtgccgagagacgatgggaa
aaatctagcagatactctgaacaatccagagaatcaaagaaaaatcaggaccggcgaaga
gaaaagtctccagcaaaacaaaaataa

DBGET integrated database retrieval system