KEGG   Homo sapiens (human): 57706Help
Entry
57706             CDS       T01001                                 

Gene name
DENND1A, FAM31A, KIAA1608
Definition
(RefSeq) DENN domain containing 1A
  KO
K20160  DENN domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    57706 (DENND1A)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    57706 (DENND1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DENN dDENN uDENN
Motif
Other DBs
NCBI-GeneID: 57706
NCBI-ProteinID: NP_065997
OMIM: 613633
HGNC: 29324
Ensembl: ENSG00000119522
Vega: OTTHUMG00000020643
Pharos: Q8TEH3(Tbio)
UniProt: Q8TEH3 Q9HCG4
Structure
PDB: 

Position
9q33.3
AA seq 1009 aa AA seqDB search
MGSRIKQNPETTFEVYVEVAYPRTGGTLSDPEVQRQFPEDYSDQEVLQTLTKFCFPFYVD
SLTVSQVGQNFTFVLTDIDSKQRFGFCRLSSGAKSCFCILSYLPWFEVFYKLLNILADYT
TKRQENQWNELLETLHKLPIPDPGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVD
VNNMLHLYASMLYERRILIICSKLSTLTACIHGSAAMLYPMYWQHVYIPVLPPHLLDYCC
APMPYLIGIHLSLMEKVRNMALDDVVILNVDTNTLETPFDDLQSLPNDVISSLKNRLKKV
STTTGDGVARAFLKAQAAFFGSYRNALKIEPEEPITFCEEAFVSHYRSGAMRQFLQNATQ
LQLFKQFIDGRLDLLNSGEGFSDVFEEEINMGEYAGSDKLYHQWLSTVRKGSGAILNTVK
TKANPAMKTVYKFAKDHAKMGIKEVKNRLKQKDIAENGCAPTPEEQLPKTAPSPLVEAKD
PKLREDRRPITVHFGQVRPPRPHVVKRPKSNIAVEGRRTSVPSPEQPQPYRTLRESDSAE
GDEAESPEQQVRKSTGPVPAPPDRAASIDLLEDVFSNLDMEAALQPLGQAKSLEDLRAPK
DLREQPGTFDYQRLDLGGSERSRGVTVALKLTHPYNKLWSLGQDDMAIPSKPPAASPEKP
SALLGNSLALPRRPQNRDSILNPSDKEEVPTPTLGSITIPRPQGRKTPELGIVPPPPIPR
PAKLQAAGAALGDVSERLQTDRDRRAALSPGLLPGVVPQGPTELLQPLSPGPGAAGTSSD
ALLALLDPLSTAWSGSTLPSRPATPNVATPFTPQFSFPPAGTPTPFPQPPLNPFVPSMPA
APPTLPLVSTPAGPFGAPPASLGPAFASGLLLSSAGFCAPHRSQPNLSALSMPNLFGQMP
MGTHTSPLQPLGPPAVAPSRIRTLPLARSSARAAETKQGLALRPGDPPLLPPRPPQGLEP
TLQPSAPQQARDPFEDLLQKTKQDVSPSPALAPAPDSVEQLRKQWETFE
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgggctccaggatcaagcagaatccagagaccacatttgaagtatatgttgaagtggcc
tatcccaggacaggtggcactctttcagatcctgaggtgcagaggcaattcccggaggac
tacagtgaccaggaagttctacagactttgaccaagttttgtttccccttctatgtggac
agcctcacagttagccaagttggccagaacttcacattcgtgctcactgacattgacagc
aaacagagattcgggttctgccgcttatcttcaggagcgaagagctgcttctgtatctta
agctatctcccctggttcgaggtattttataagctgcttaacatcctggcagattacacg
acaaaaagacaggaaaatcagtggaatgagcttcttgaaactctgcacaaacttcccatc
cctgacccaggagtgtctgtccatctcagcgtgcattcttattttactgtgcctgatacc
agagaacttcccagcatacctgagaatagaaatctgacagaatattttgtggctgtggat
gttaacaacatgttgcatctgtacgccagtatgctgtacgaacgccggatactcatcatt
tgcagcaaactcagcactctgactgcctgcatccacgggtctgcggcgatgctctacccc
atgtactggcagcacgtgtacatccccgtgctgccgccgcatctgctggactactgctgt
gctcccatgccctacctcataggaatccatttaagtttaatggagaaagtcagaaacatg
gccctggatgatgtcgtgatcctgaatgtggacaccaacaccctggaaacccccttcgat
gacctccagagcctcccaaacgacgtgatctcttccctgaagaacaggctgaaaaaggtc
tccacaaccactggggatggtgtggccagagcgttcctcaaggcccaggctgctttcttc
ggtagctaccgaaacgctctgaaaatcgagccggaggagccgatcactttctgtgaggaa
gccttcgtgtcccactaccgctccggagccatgaggcagttcctgcagaacgccacacag
ctgcagctcttcaagcagtttattgatggtcgattagatcttctcaattccggcgaaggt
ttcagtgatgtttttgaagaggaaatcaacatgggcgagtacgctggcagtgacaaactg
taccatcagtggctctccactgtccggaaaggaagtggagcaattctgaatactgtaaag
accaaagcaaatccggccatgaagactgtctacaagttcgcaaaagatcatgcaaaaatg
ggaataaaagaggtgaaaaaccgcttgaagcaaaaggacattgccgagaatggctgcgcc
cccaccccagaagagcagctgccaaagactgcaccgtccccactggtggaggccaaggac
cccaagctccgagaagaccggcggccaatcacagtccactttggacaggtgcgcccacct
cgtccacatgttgttaagagaccaaagagcaacatcgcagtggaaggccggaggacgtct
gtgccgagccctgagcagccgcagccgtatcggacactcagggagtcagacagcgcggaa
ggcgacgaggcagagagtccagagcagcaagtgcggaagtccacaggccctgtcccagct
ccccctgaccgggctgccagcatcgaccttctggaagacgtcttcagcaacctggacatg
gaggccgcactgcagccactgggccaggccaagagcttagaggaccttcgtgcccccaaa
gacctgagggagcagccagggacctttgactatcagaggctggatctgggcgggagtgag
aggagccgcggggtgacagtggccttgaagcttacccacccgtacaacaagctctggagc
ctgggccaggacgacatggccatccccagcaagcccccagctgcctcccctgagaagccc
tcggccctgctcgggaactccctggccctgcctcgaaggccccagaaccgggacagcatc
ctgaaccccagtgacaaggaggaggtgcccacccctactctgggcagcatcaccatcccc
cggccccaaggcaggaagaccccagagctgggcatcgtgcctccaccgcccattccccgc
ccggccaagctccaggctgccggcgccgcacttggtgacgtctcagagcggctgcagacg
gatcgggacaggcgagctgccctgagtccagggctcctgcctggtgttgtcccccaaggc
cccactgaactgctccagccgctcagccctggccccggggctgcaggcacgagcagtgac
gccctgctcgccctcctggacccgctcagcacagcctggtcaggcagcaccctcccgtca
cgccccgccaccccgaatgtagccaccccattcaccccccaattcagcttcccccctgca
gggacacccaccccattcccacagccaccactcaacccctttgtcccatccatgccagca
gccccacccaccctgcccctggtctccacaccagccgggcctttcggggcccctccagct
tccctggggccggcttttgcgtccggcctcctgctgtccagtgctggcttctgtgcccct
cacaggtctcagcccaacctctccgccctctccatgcccaacctctttggccagatgccc
atgggcacccacacgagccccctacagccgctgggtcccccagcagttgccccgtcgagg
atccgaacgttgcccctggcccgctcaagtgccagggctgctgagaccaagcaggggctg
gccctgaggcctggagaccccccgcttctgcctcccaggccccctcaaggcctggagcca
acactgcagccctctgctcctcaacaggccagagacccctttgaggatttgttacagaaa
accaagcaagacgtgagcccgagtccggccctggccccggccccagactcggtggagcag
ctcaggaagcagtgggagaccttcgagtga

DBGET integrated database retrieval system