KEGG   Homo sapiens (human): 57709
Entry
57709             CDS       T01001                                 
Symbol
SLC7A14, PPP1R142
Name
(RefSeq) solute carrier family 7 member 14
  KO
K13871  solute carrier family 7 (cationic amino acid transporter), member 14
Organism
hsa  Homo sapiens (human)
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    57709 (SLC7A14)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    57709 (SLC7A14)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     57709 (SLC7A14)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   57709 (SLC7A14)
SSDB
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Other DBs
NCBI-GeneID: 57709
NCBI-ProteinID: NP_066000
OMIM: 615720
HGNC: 29326
Ensembl: ENSG00000013293
Pharos: Q8TBB6(Tdark)
UniProt: Q8TBB6
Position
3:complement(170459548..170586075)
AA seq 771 aa
MSGFFTSLDPRRVQWGAAWYAMHSRILRTKPVESMLEGTGTTTAHGTKLAQVLTTVDLIS
LGVGSCVGTGMYVVSGLVAKEMAGPGVIVSFIIAAVASILSGVCYAEFGVRVPKTTGSAY
TYSYVTVGEFVAFFIGWNLILEYLIGTAAGASALSSMFDSLANHTISRWMADSVGTLNGL
GKGEESYPDLLALLIAVIVTIIVALGVKNSIGFNNVLNVLNLAVWVFIMIAGLFFINGKY
WAEGQFLPHGWSGVLQGAATCFYAFIGFDIIATTGEEAKNPNTSIPYAITASLVICLTAY
VSVSVILTLMVPYYTIDTESPLMEMFVAHGFYAAKFVVAIGSVAGLTVSLLGSLFPMPRV
IYAMAGDGLLFRFLAHVSSYTETPVVACIVSGFLAALLALLVSLRDLIEMMSIGTLLAYT
LVSVCVLLLRYQPESDIDGFVKFLSEEHTKKKEGILADCEKEACSPVSEGDEFSGPATNT
CGAKNLPSLGDNEMLIGKSDKSTYNVNHPNYGTVDMTTGIEADESENIYLIKLKKLIGPH
YYTMRIRLGLPGKMDRPTAATGHTVTICVLLLFILMFIFCSFIIFGSDYISEQSWWAILL
VVLMVLLISTLVFVILQQPENPKKLPYMAPCLPFVPAFAMLVNIYLMLKLSTITWIRFAV
WCFVGLLIYFGYGIWNSTLEISAREEALHQSTYQRYDVDDPFSVEEGFSYATEGESQEDW
GGPTEDKGFYYQQMSDAKANGRTSSKAKSKSKHKQNSEALIANDELDYSPE
NT seq 2316 nt   +upstreamnt  +downstreamnt
atgagtggcttcttcacctcgctggacccccggcgggtgcagtggggagctgcctggtat
gcaatgcactccaggatcctacgcaccaaaccagtggagtccatgctagagggaactggg
accaccacggcacatggaactaagctagcccaggtactcaccacagtggacctcatctct
cttggcgttggcagctgtgtgggcactggcatgtatgtggtctctggcctggtggccaag
gaaatggcaggacctggtgtcattgtgtccttcatcattgcagccgtcgcatccatatta
tcaggcgtctgctatgcagagtttggagttcgagtccccaagaccacaggatctgcctac
acctacagctatgtcactgttggggaatttgtggcatttttcattggctggaacctgatc
ctggagtacctgattggcactgcggccggagccagtgctctgagcagcatgtttgactca
ctagccaaccacaccatcagccgctggatggcggacagcgtgggaaccctcaatggcctg
gggaaaggtgaagaatcatacccagaccttctggctctgttgatcgcggtcatcgtgacc
atcattgttgctctgggggtgaagaattccataggcttcaacaatgttctcaatgtgctg
aacctggcagtatgggtgttcatcatgatcgcaggcctcttcttcatcaatgggaaatac
tgggcggagggccagttcttgccccacggctggtcaggggtgctgcaaggagcagcaaca
tgcttctacgctttcattggctttgacatcatcgccaccactggagaggaagccaagaat
cccaacacgtccatcccttatgctatcactgcctccctggtcatctgcctgacagcatat
gtgtctgtgagcgtgatcttaactctgatggtgccatattataccattgacacggaatcc
ccactcatggagatgtttgtggctcatgggttctatgctgccaaattcgtagtggccatt
gggtcggttgcaggactgacagtcagcttgctggggtccctcttcccgatgccgagggtc
atttatgccatggctggtgacgggctccttttcaggttcctggctcacgtcagctcctac
acagagacaccagtggtggcctgcatcgtgtcggggttcctggcagcgctcctcgcactg
ttggtcagcttgagagacctgatagagatgatgtctatcggcacgctcctggcctacacc
ttggtctctgtctgtgtcttgctccttcgataccaacctgagagtgacattgatggtttt
gtcaagttcttgtctgaggagcacaccaagaagaaggagggcattctggctgactgtgag
aaggaagcttgttctcctgtgagtgagggggatgagttttctggcccagccaccaacaca
tgtggggccaagaacttaccatccttgggagacaatgagatgctcatagggaaatcagac
aagtcaacctacaacgtcaaccaccccaattacggcaccgtggacatgaccacaggcata
gaagctgatgaatccgaaaatatttatctcatcaagttaaagaagctgattgggcctcat
tattacaccatgagaatccggctgggccttccaggcaaaatggaccggcccacagcagcg
acggggcacacggtgaccatctgcgtgctcctgctcttcatcctcatgttcatcttctgc
tccttcatcatctttggttctgactacatctcagagcagagctggtgggccatccttctg
gttgttctgatggtgctgctgatcagcaccctggtgtttgtgatcctgcagcagccagag
aaccccaagaagctgccctacatggccccttgcctcccctttgtgcctgcctttgccatg
ctggtgaacatctatctcatgctaaagctctccaccatcacatggatccggtttgcggtc
tggtgctttgtgggtctgctcatttattttggatatggcatctggaacagcaccctggaa
atcagcgctcgagaagaggccctgcaccaaagcacgtaccaacgctacgacgtggatgac
cccttctcagtggaggagggtttctcctacgccacagagggcgagagccaggaggactgg
ggcgggcccactgaagacaaaggcttctattaccaacagatgtcagatgcgaaggcaaac
ggccggacaagtagcaaagcgaagagcaaaagcaaacacaaacagaactcagaggccctg
attgcaaatgatgagttagattactctccagagtag

DBGET integrated database retrieval system