KEGG   Homo sapiens (human): 57720
Entry
57720             CDS       T01001                                 

Gene name
GPR107, GCDRP, LUSTR1, bA138E2.2
Definition
(RefSeq) G protein-coupled receptor 107
  KO
K22985  G protein-coupled receptor 107
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    57720 (GPR107)
G protein-coupled receptors [BR:hsa04030]
 Others
  Others
   Neuronostatin
    57720 (GPR107)
SSDB
Motif
Pfam: Lung_7-TM_R GpcrRhopsn4 Sas10_Utp3
Other DBs
NCBI-GeneID: 57720
NCBI-ProteinID: NP_001130029
OMIM: 618490
HGNC: 17830
Ensembl: ENSG00000148358
Vega: OTTHUMG00000020804
Pharos: Q5VW38(Tdark)
UniProt: Q5VW38
Position
9q34.11
AA seq 600 aa
MAALAPVGSPASRGPRLAAGLRLLPMLGLLQLLAEPGLGRVHHLALKDDVRHKVHLNTFG
FFKDGYMVVNVSSLSLNEPEDKDVTIGFSLDRTKNDGFSSYLDEDVNYCILKKQSVSVTL
LILDISRSEVRVKSPPEAGTQLPKIIFSRDEKVLGQSQEPNVNPASAGNQTQKTQDGGKS
KRSTVDSKAMGEKSFSVHNNGGAVSFQFFFNISTDDQEGLYSLYFHKCLGKELPSDKFTF
SLDIEITEKNPDSYLSAGEIPLPKLYISMAFFFFLSGTIWIHILRKRRNDVFKIHWLMAA
LPFTKSLSLVFHAIDYHYISSQGFPIEGWAVVYYITHLLKGALLFITIALIGTGWAFIKH
ILSDKDKKIFMIVIPLQVLANVAYIIIESTEEGTTEYGLWKDSLFLVDLLCCGAILFPVV
WSIRHLQEASATDGKGDSMGPLQQRANLRAGSRIESHHFAQADLELLASSCPPASVSQRA
GITAAINLAKLKLFRHYYVLIVCYIYFTRIIAFLLKLAVPFQWKWLYQLLDETATLVFFV
LTGYKFRPASDNPYLQLSQEEEDLEMESVVTTSGVMESMKKVKKVTNGSVEPQGEWEGAV
NT seq 1803 nt   +upstreamnt  +downstreamnt
atggccgctctggcgcccgtcggctcccccgcctcccgcggtcctaggctggccgcgggc
ctccggctgctcccaatgctgggtttgctgcagttgctggccgagcctggcctgggccgc
gtccatcacctggcactcaaggatgatgtgaggcataaagttcatctgaacacctttggc
ttcttcaaggatgggtacatggtggtgaatgtcagtagcctctcactgaatgagcctgaa
gacaaggatgtgactattggatttagcctagaccgtacaaagaatgatggcttttcttct
tacctggatgaagatgtgaattactgtattttaaagaaacagtctgtctctgtcaccctt
ttaatcctagacatctccagaagtgaggtaagagtaaagtctccaccagaagctggtacc
cagttaccaaagatcatcttcagcagggatgagaaagtccttggtcagagccaggagcct
aatgttaaccctgcttcagcaggcaaccagacccagaagacacaagatggtggaaagtct
aaaagaagtacagtggattcaaaggccatgggagagaaatccttttctgttcataataat
ggtggggcagtgtcatttcagtttttctttaacatcagcactgatgaccaagaaggcctt
tacagtctttattttcataaatgccttggaaaagaattgccaagtgacaagtttacattc
agccttgatattgagatcacagagaagaatcctgacagctacctctcagcaggagaaatt
cctctccccaaattatacatctcaatggcctttttcttctttctttctgggaccatctgg
attcatatccttcgaaaacgacggaatgatgtatttaaaatccactggctgatggcggcc
cttcctttcaccaagtctctttccttggtgttccatgcaattgactaccactacatctcc
tcccagggcttccctatcgaaggctgggctgttgtgtactacataactcaccttttgaaa
ggggcgctactcttcatcaccattgcactcattggcactggctgggctttcattaagcac
atcctttctgataaagacaaaaagatcttcatgattgtcattccactccaggtcctggca
aatgtagcctacatcatcatagagtccaccgaggagggcacgactgaatatggcttgtgg
aaggactctctatttctggtcgacctgttgtgttgtggtgccatcctcttcccagtggtg
tggtcaatcagacatttacaagaagcatcagcaacagatggaaaaggtgacagcatggga
cctcttcagcagagagcgaatctaagagcaggaagtcgcatagagtctcaccattttgcc
caggctgatcttgaactcctggcctctagctgtcctcctgcctcagtctcccaaagggct
gggattacagctgctattaacttagcaaagctgaaacttttcagacattattacgtcttg
attgtgtgttacatatacttcactaggatcattgcatttctcctcaaactcgctgttcca
ttccagtggaagtggctctaccagctcctggatgaaacggccacactggtcttctttgtt
ctaacggggtataaattccgtccggcttcagataacccctacctacaactttctcaggaa
gaagaagacttggaaatggagtccgttgtgacaacatctggggtgatggaaagtatgaag
aaagtcaagaaggtgaccaacggctccgtggagccccagggcgagtgggaaggcgccgtg
tga

DBGET integrated database retrieval system