KEGG   Homo sapiens (human): 57733
Entry
57733             CDS       T01001                                 

Gene name
GBA3, CBG, CBGL1, GLUC, KLRP
Definition
(RefSeq) glucosylceramidase beta 3 (gene/pseudogene)
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    57733 (GBA3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     57733 (GBA3)
SSDB
Motif
Pfam: Glyco_hydro_1 Cellulase PAR1
Other DBs
NCBI-GeneID: 57733
NCBI-ProteinID: NP_066024
OMIM: 606619
HGNC: 19069
Ensembl: ENSG00000249948
Vega: OTTHUMG00000160448
Pharos: Q9H227(Tbio)
UniProt: Q9H227 A8K9N1
Structure
PDB: 
2E9L 2E9M 2ZOX 3VKK 2JFE

Position
4p15.2
AA seq 469 aa
MAFPAGFGWAAATAAYQVEGGWDADGKGPCVWDTFTHQGGERVFKNQTGDVACGSYTLWE
EDLKCIKQLGLTHYRFSLSWSRLLPDGTTGFINQKGIDYYNKIIDDLLKNGVTPIVTLYH
FDLPQTLEDQGGWLSEAIIESFDKYAQFCFSTFGDRVKQWITINEANVLSVMSYDLGMFP
PGIPHFGTGGYQAAHNLIKAHARSWHSYDSLFRKKQKGMVSLSLFAVWLEPADPNSVSDQ
EAAKRAITFHLDLFAKPIFIDGDYPEVVKSQIASMSQKQGYPSSRLPEFTEEEKKMIKGT
ADFFAVQYYTTRLIKYQENKKGELGILQDAEIEFFPDPSWKNVDWIYVVPWGVCKLLKYI
KDTYNNPVIYITENGFPQSDPAPLDDTQRWEYFRQTFQELFKAIQLDKVNLQVYCAWSLL
DNFEWNQGYSSRFGLFHVDFEDPARPRVPYTSAKEYAKIIRNNGLEAHL
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggctttccctgcaggatttggatgggcggcagccactgcagcttatcaagtagaagga
ggctgggatgcagatggaaaaggcccttgtgtctgggacacatttactcatcagggagga
gagagagttttcaagaaccagactggcgatgtagcttgtggcagctacactctgtgggag
gaagatttgaaatgtatcaaacagcttggattgactcattaccgcttctctctttcctgg
tcacgtctgttacctgatgggacgacaggtttcatcaaccagaaaggaattgattattac
aacaagatcatcgatgatttgttaaaaaatggggttactcccattgtgaccctctaccac
tttgatttgcctcagactttagaagaccaaggaggttggttgtcagaggcaatcattgaa
tcctttgacaaatatgctcagttttgcttcagtacctttggggatcgtgtcaagcagtgg
atcaccataaatgaagctaatgttctttctgtgatgtcatatgacttaggtatgtttcct
ccgggtatccctcactttgggactggaggttatcaggcagctcataatttgattaaggct
catgccagatcctggcacagctatgattccttatttcgaaaaaagcagaaaggtatggtg
tctctatcactttttgcggtctggttggaaccagcagatcccaactcagtgtctgaccag
gaagctgctaaaagagccatcactttccatctggatttatttgctaaacccatattcatc
gatggtgattatcctgaagttgtcaagtctcagattgcctccatgagtcaaaagcaaggc
tatccatcatcgaggcttccagaattcactgaagaagagaagaaaatgatcaaaggcact
gctgatttttttgctgtgcaatattatacaactcgcttaatcaagtaccaggagaacaag
aaaggagaactaggtattctccaggatgcggaaattgaattttttccagatccatcttgg
aaaaatgtggattggatctacgtggtaccatggggagtatgtaaactactgaaatatatt
aaggatacatataataaccctgtaatttacatcactgagaatgggtttccccagagtgac
ccagcgcctcttgatgacactcaacgctgggagtatttcagacaaacatttcaggaactg
ttcaaagctatccaacttgataaagtcaatcttcaagtatattgtgcatggtctcttctg
gataactttgagtggaaccagggatacagcagccggtttggtctcttccacgttgatttt
gaagacccagctagaccccgagtcccttacacatcggccaaggaatatgccaagatcatc
cgaaacaatggccttgaagcacatctgtag

DBGET integrated database retrieval system