KEGG   Homo sapiens (human): 5774
Entry
5774              CDS       T01001                                 

Gene name
PTPN3, PTP-H1, PTPH1
Definition
(RefSeq) protein tyrosine phosphatase non-receptor type 3
  KO
K18027  tyrosine-protein phosphatase non-receptor type 3 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5774 (PTPN3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5774 (PTPN3)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    5774 (PTPN3)
SSDB
Motif
Pfam: Y_phosphatase FERM_C FERM_N FERM_M PDZ DSPc Y_phosphatase3 PTPlike_phytase PDZ_6
Other DBs
NCBI-GeneID: 5774
NCBI-ProteinID: NP_002820
OMIM: 176877
HGNC: 9655
Ensembl: ENSG00000070159
Vega: OTTHUMG00000020475
Pharos: P26045(Tbio)
UniProt: P26045 B7Z9V1 Q8N4S3
Structure
PDB: 

Position
9q31.3
AA seq 913 aa
MTSRLRALGGRINNIRTSELPKEKTRSEVICSIHFLDGVVQTFKVTKQDTGQVLLDMVHN
HLGVTEKEYFGLQHDDDSVDSPRWLEASKAIRKQLKGGFPCTLHFRVRFFIPDPNTLQQE
QTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSHFIPDQ
NEDFLTKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHSGRDLHNLDLMIGIASAG
VAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKS
CVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNTKKSVNNQYCKKVIGGMVWNPAMRRSLSV
EHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSL
APQDSDSEVSQNRSPHQESLSENNPAQSYLTQKSSSSVSPSSNAPGSCSPDGVDQQLLDD
FHRVTKGGSTEDASQYYCDKNDNGDSYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRI
NPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRRAVR
SFADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGL
AITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGP
LPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGFHIQCQSEDCT
IAYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDSEPVLV
HCSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILR
VYEEGLVQMLDPS
NT seq 2742 nt   +upstreamnt  +downstreamnt
atgacctcccggttacgtgcgttgggtggaagaattaataatatacgcacctcggagtta
cccaaagagaaaactcgatcagaagtcatttgcagcatccactttttagatggcgtggta
cagacctttaaagttactaaacaagacactggccaggttcttctggatatggtgcacaac
cacctgggtgtgactgaaaaggaatattttggtttacagcatgatgacgactccgtggac
tctcctagatggctggaagcaagcaaagccatcaggaagcagttaaaaggaggtttcccc
tgtaccctgcattttcgagtaagattttttatacctgatcccaacacactgcagcaagaa
caaaccaggcacttgtatttcttacaactgaagatggatatttgcgaaggaaggttaacc
tgccctcttaactcagcagtggttctagcgtcctatgccgtacaatctcattttggagac
tataattcttccatacatcatccaggctatctttccgatagtcactttatacccgatcaa
aatgaggactttttaacaaaagtcgaatctctgcatgagcagcacagtgggctaaaacaa
tcagaagcagaatcctgctatatcaacatagcgcggaccctcgacttctatggagtagaa
ctgcacagtggtagggatctgcacaatttagacctaatgattggaattgcttccgcgggt
gttgctgtgtaccgaaaatacatttgcacaagtttctatccttgggtgaacattctcaaa
atttctttcaaaaggaaaaagttcttcatacatcagcgacagaaacaggctgaatccagg
gaacatattgtggccttcaacatgctgaattaccgatcttgcaaaaacttgtggaaatcc
tgtgttgagcaccatacgttctttcaggcaaagaagctactacctcaggaaaagaatgtt
ctgtctcagtactggactatgggctctcggaacaccaaaaagtcggtaaataaccaatat
tgcaaaaaggtgattggcgggatggtgtggaacccagccatgcggagatccttatcagtg
gagcacttagaaaccaagagtctgccttctcgttcccctcccattactcccaactggcga
agtcctcggctccggcacgaaatccgaaagccacgccactcttctgcagataaccttgca
aatgaaatgacctacatcacggaaacggaagatgtattttacacgtacaagggctctctg
gcccctcaagacagcgattctgaagtttctcagaaccgaagcccgcaccaagagagttta
tccgagaacaatccggcacaaagctacctgacccagaagtcatccagttctgtgtctcca
tcttcaaatgctccaggctcctgctcacctgacggcgttgatcagcagctcttagatgac
ttccacagggtgaccaaagggggctccaccgaggacgccagccagtactactgtgacaag
aatgataatggtgacagctacttagtcttgatccgtatcacaccagatgaagatggaaaa
tttggatttaatcttaagggaggagtggatcaaaagatgcctcttgtggtatcaaggata
aacccagagtcacctgcggacacctgcattcctaagctgaacgaaggggatcaaatcgtg
ttaatcaatggccgggacatctcagaacacacgcatgaccaagtggtgatgttcatcaaa
gccagccgggagtcccactcacgggagctggccctggtgatcaggaggagagctgtccgc
tcatttgctgacttcaagtctgaagatgaactgaaccagcttttccccgaagccattttc
cccatgtgtccggagggtggggacactttggagggatccatggcacagctaaagaagggc
ctcgaaagcgggacggtgctgatccagtttgagcaactctacagaaaaaagccaggtttg
gccatcacgtttgcaaagctgcctcaaaatttggacaaaaaccgatataaagatgtgctg
ccttatgacaccacccgggtattattgcagggaaatgaagattatattaatgcaagttac
gtgaacatggaaattcctgctgctaaccttgtgaacaagtacatcgccactcaggggccc
ctgccgcatacctgtgcacagttttggcaggttgtctgggatcagaagttgtcactcatt
gtcatgttgacgactctcacagaacgagggcggaccaaatgtcaccagtactggccagat
ccccccgacgtcatgaaccacggcggctttcacatccagtgtcagtcagaggactgcacc
atcgcctatgtgtcccgagaaatgctggtcacaaacacccagaccggggaagaacacaca
gtgacacatctccagtacgtcgcatggcctgaccacggtgtgcccgatgactcctccgac
tttctggaatttgtaaactatgtgaggtctctgagagtggacagcgagcccgtcctagtt
cactgcagtgctggaataggtcgaaccggtgtgttggtcactatggaaacagccatgtgc
ctaactgagaggaacctgcccatttacccactggatattgtccgaaaaatgcgagaccag
cgcgccatgatggtgcagacatcaagccagtacaagtttgtgtgtgaagcgattcttcgt
gtgtatgaagaaggtttagtccaaatgctggatcctagttaa

DBGET integrated database retrieval system