KEGG   Homo sapiens (human): 5775
Entry
5775              CDS       T01001                                 

Gene name
PTPN4, MEG, PTPMEG, PTPMEG1
Definition
(RefSeq) protein tyrosine phosphatase non-receptor type 4
  KO
K18037  tyrosine-protein phosphatase non-receptor type 4 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5775 (PTPN4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5775 (PTPN4)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    5775 (PTPN4)
SSDB
Motif
Pfam: Y_phosphatase FERM_C FERM_M FERM_N PDZ FA DSPc Y_phosphatase3 PTPlike_phytase PDZ_6
Other DBs
NCBI-GeneID: 5775
NCBI-ProteinID: NP_002821
OMIM: 176878
HGNC: 9656
Ensembl: ENSG00000088179
Vega: OTTHUMG00000131436
Pharos: P29074(Tbio)
UniProt: P29074
Structure
PDB: 

Position
2q14.2
AA seq 926 aa
MTSRFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTVQAFKVNKHDQGQVLLDVVFK
HLDLTEQDYFGLQLADDSTDNPRWLDPNKPIRKQLKRGSPYSLNFRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLPCPSNTAALLASFAVQSELGDYDQSENLSGYLSDYSFIPNQ
PQDFEKEIAKLHQQHIGLSPAEAEFNYLNTARTLELYGVEFHYARDQSNNEIMIGVMSGG
ILIYKNRVRMNTFPWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKNLWKA
CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPS
KPLARKLMDWEVVSRNSISDDRLETQSLPSRSPPGTPNHRNSTFTQEGTRLRPSSVGHLV
DHMVHTSPSEVFVNQRSPSSTQANSIVLESSPSQETPGDGKPPALPPKQSKKNSWNQIHY
SHSQQDLESHINETFDIPSSPEKPTPNGGIPHDNLVLIRMKPDENGRFGFNVKGGYDQKM
PVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELMLL
VRPNAVYDVVEEKLENEPDFQYIPEKAPLDSVHQDDHSLRESMIQLAEGLITGTVLTQFD
QLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSSII
NQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQ
VTCHSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNK
RAGKEEPVVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQ
YRFVCEAILKVYEEGFVKPLTTSTNK
NT seq 2781 nt   +upstreamnt  +downstreamnt
atgacctcacgtttccgattgcctgctggcagaacctacaatgtacgagcatcagagttg
gcccgagacagacagcatactgaagtggtttgcaacatccttcttctggataacactgta
caagctttcaaagtcaataaacatgatcaggggcaagtcttgttggatgtcgtcttcaag
catctagatttgactgagcaggactattttggtttacagttggctgatgattccacagat
aacccaaggtggctggatccaaacaaaccaataaggaagcagctaaagagaggatctcct
tacagtttgaactttagagtcaaattttttgtaagtgaccccaacaagttacaagaagaa
tatacaaggtaccagtattttttgcaaattaaacaagacattcttactggaagattaccc
tgtccttctaatactgctgcccttttagcttcatttgctgttcagtctgaacttggagac
tacgatcagtcagagaacttgtcaggctacctctcagattattctttcattcctaatcaa
cctcaagattttgaaaaagaaattgcaaaattacatcagcaacacataggcttatctcct
gcagaagcagaatttaattacctaaacacagcacgtaccttagaactctatggagttgaa
ttccactatgcaagggatcagagtaacaatgaaattatgattggagtgatgtcaggagga
attctgatttataagaacagggtacgaatgaatacctttccatggttgaagattgtaaaa
atttcttttaagtgcaaacagttttttattcaacttagaaaagaattgcatgaatctaga
gaaacattattgggatttaatatggtgaattacagagcatgtaaaaatttgtggaaagca
tgtgtagaacatcacacattcttccgtttggacagaccacttccacctcaaaagaatttt
tttgcacattattttacattaggttcaaaattccggtactgtgggagaactgaagtccaa
tcagttcagtatggcaaagaaaaggcaaataaagacagggtatttgcaagatccccaagt
aagcccttggcacggaaattaatggattgggaagtagtaagcagaaattcaatatctgat
gacaggttagaaacacaaagtcttccatcacgatctccaccgggaactcctaatcatcga
aattctacattcacgcaggaaggaacccggttacgaccatcttcagttggtcatttggta
gaccatatggttcatacttccccaagcgaagtgtttgtaaatcagagatctccgtcatca
acacaagctaatagcattgttctggaatcatcaccatcacaagagacccctggagatggg
aagcctccagctttaccacccaaacagtcaaagaaaaacagttggaaccaaattcattat
tcacattcgcaacaagatctagaaagtcatattaatgaaacatttgatattccatcttct
cctgaaaaacccactcctaatggtggtattccacatgataatcttgtcctaatcagaatg
aaacctgatgaaaatgggaggtttggattcaatgtaaagggaggatatgatcagaagatg
cctgtgattgtgtctcgagtagcaccaggaacacctgctgacctctgtgtccctagactg
aatgaaggggaccaagttgtactgatcaatggtcgggacattgcagaacacactcatgat
caggttgtgctgtttattaaagctagttgtgagagacattctggggaactcatgcttcta
gttcgacctaatgctgtatatgatgtagtggaagaaaagctagaaaatgagccagatttc
cagtatattcctgagaaagccccactagatagtgtgcatcaggatgaccattccctgcgg
gagtcaatgatccagctagctgaggggcttatcactggaacagtcctgacacagtttgat
caactgtatcggaaaaaacctggaatgacaatgtcctgtgccaaattacctcagaatatt
tccaaaaatagatacagagatatttcgccttatgatgccacacgggtcattttaaaaggt
aatgaagactacatcaatgcgaactatataaatatggaaattccttcttccagcattata
aatcagtacattgcttgtcaagggccattaccacacacttgtacagatttttggcagatg
acttgggaacaaggctcctctatggttgtaatgttgaccacacaagttgaacgtggcaga
gttaaatgtcaccaatattggccagaacccacaggcagttcatcttatggatgctaccaa
gttacctgccactctgaagaaggaaacactgcctatatcttcaggaagatgaccctattt
aaccaagagaaaaatgaaagtcgtccactcactcagatccagtacatagcctggcctgac
catggagtccctgatgattcgagtgactttctagattttgtttgtcatgtacgaaacaag
agggctggcaaggaagaacccgttgttgtccattgcagtgctggaatcggaagaactggg
gttcttattactatggaaacagccatgtgtctcattgaatgcaatcagccagtttatcca
ctagatattgtaagaacaatgagagatcagcgagccatgatgatccaaacacctagtcaa
tacagatttgtatgtgaagctattttgaaagtttatgaagaaggctttgttaaaccctta
acaacatcaacaaataaataa

DBGET integrated database retrieval system