KEGG   Homo sapiens (human): 57761Help
Entry
57761             CDS       T01001                                 

Gene name
TRIB3, C20orf97, NIPK, SINK, SKIP3, TRB3
Definition
(RefSeq) tribbles pseudokinase 3
  KO
K19518  tribbles homolog 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    57761 (TRIB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    57761 (TRIB3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  Trbl family
   57761 (TRIB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 57761
NCBI-ProteinID: NP_001288117
OMIM: 607898
HGNC: 16228
Ensembl: ENSG00000101255
Vega: OTTHUMG00000031627
Pharos: Q96RU7(Tbio)
UniProt: Q96RU7
Position
20p13
AA seq 358 aa AA seqDB search
MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRAT
AVATASRLGPYVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV
ARPTEVLAGTQLLYAFFTRTHGDMHSLVRSRHRIPEPEAAVLFRQMATALAHCHQHGLVL
RDLKLCRFVFADRERKKLVLENLEDSCVLTGPDDSLWDKHACPAYVGPEILSSRASYSGK
AADVWSLGVALFTMLAGHYPFQDSEPVLLFGKIRRGAYALPAGLSAPARCLVRCLLRREP
AERLTATGILLHPWLRQDPMPLAPTRSHLWEAAQVVPDGLGLDEAREEEGDREVVLYG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcgagccacccctctggctgctcctgcgggttccctgtccaggaagaagcggttggag
ttggatgacaacttagataccgagcgtcccgtccagaaacgagctcgaagtgggccccag
cccagactgcccccctgcctgttgcccctgagcccacctactgctccagatcgtgcaact
gctgtggccactgcctcccgtcttgggccctatgtcctcctggagcccgaggagggcggg
cgggcctaccaggccctgcactgccctacaggcactgagtatacctgcaaggtgtacccc
gtccaggaagccctggccgtgctggagccctatgcgcggctgcccccgcacaagcatgtg
gctcggcccactgaggtcctggctggtacccagctcctctacgcctttttcactcggacc
catggggacatgcacagcctggtgcgaagccgccaccgtatccctgagcctgaggctgcc
gtgctcttccgccagatggccaccgccctggcgcactgtcaccagcacggtctggtcctg
cgtgatctcaagctgtgtcgctttgtcttcgctgaccgtgagaggaagaagctggtgctg
gagaacctggaggactcctgcgtgctgactgggccagatgattccctgtgggacaagcac
gcgtgcccagcctacgtgggacctgagatactcagctcacgggcctcatactcgggcaag
gcagccgatgtctggagcctgggcgtggcgctcttcaccatgctggccggccactacccc
ttccaggactcggagcctgtcctgctcttcggcaagatccgccgcggggcctacgccttg
cctgcaggcctctcggcccctgcccgctgtctggttcgctgcctccttcgtcgggagcca
gctgaacggctcacagccacaggcatcctcctgcacccctggctgcgacaggacccgatg
cccttagccccaacccgatcccatctctgggaggctgcccaggtggtccctgatggactg
gggctggacgaagccagggaagaggagggagacagagaagtggttctgtatggctag

DBGET integrated database retrieval system