KEGG   Homo sapiens (human): 57798
Entry
57798             CDS       T01001                                 

Gene name
GATAD1, CMD2B, ODAG, RG083M05.2
Definition
(RefSeq) GATA zinc finger domain containing 1
  KO
K23407  GATA zinc finger domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Disease
H00294  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    57798 (GATAD1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Other histone modification proteins
    57798 (GATAD1)
SSDB
Motif
Pfam: GATA
Other DBs
NCBI-GeneID: 57798
NCBI-ProteinID: NP_066990
OMIM: 614518
HGNC: 29941
Ensembl: ENSG00000157259
Vega: OTTHUMG00000131201
Pharos: Q8WUU5(Tbio)
UniProt: Q8WUU5
Position
7q21.2
AA seq 269 aa
MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGRGGAGSGGAGSGAAGGTGGSGGGGF
GAATFASTSATPPQSNGGGGGKQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHI
FKLKNPIKAPESVSTIITAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCE
KSAALTWLIPTLSSPRDQFDPASYIIGPEEDLPRKMEYLEFVCHAPSEYFKSRSSPFPTV
PTRPEKGYIWTHVGPTPAITIKESVANHL
NT seq 810 nt   +upstreamnt  +downstreamnt
atgccgctgggcctgaagcccacctgcagcgtatgcaagaccacgtcgtcctccatgtgg
aagaagggagcgcagggggagatcctctgccatcattgcactggccggggcggcgcgggc
agcgggggcgcaggctcgggggcggctggagggactgggggcagcggcggcggcggcttc
ggcgcggcgaccttcgccagcacctccgccacccctccgcagagcaacgggggcgggggc
ggcaagcagagtaagcaggaaattcacaggaggtctgctcggctcagaaacactaaatac
aaatctgctccggctgctgaaaagaaagtctccaccaaaggaaaagggagaagacatata
tttaaattgaaaaatcccatcaaagctcctgagtcagtttccactataatcactgcagaa
tcaatcttctacaagggagtatattaccaaattggtgatgttgtttctgtgattgatgaa
caagatggaaagccctactatgctcaaatcagaggttttatccaggaccagtattgcgag
aagagtgcagcactgacgtggctcattcctaccctctctagccccagagaccaatttgat
cccgcctcctatatcatagggccagaggaagatcttccaaggaagatggaatacttggaa
tttgtttgtcatgcaccttctgagtatttcaagtcacggtcatcaccatttcccacagtt
cccaccagaccagagaagggctacatatggactcatgttgggcctactcctgcaataaca
attaaggaatcagttgccaaccatttgtag

DBGET integrated database retrieval system