KEGG   Homo sapiens (human): 578Help
Entry
578               CDS       T01001                                 

Gene name
BAK1, BAK, BAK-LIKE, BCL2L7, CDN1
Definition
(RefSeq) BCL2 antagonist/killer 1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
N00098  Intrinsic apoptotic pathway
N00115  Mutation-inactivated TP53 to transcription
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00164  KSHV vBCL2 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00223  EBV EBNA1 to p53-mediated transcription
N00262  EBV EBNA3C to intrinsic apoptotic pathway
N00263  EBV EBNA3C to p53-mediated transcription
N00383  HPV E6 to intrinsic apoptotic pathway
N00425  HCMV UL36 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00449  HIV Tat/Nef to crosstalk between extrinsic and intrinsic apoptotic pathways
N00451  HIV Tat to intrinsic apoptotic pathway
N00452  HIV Nef to intrinsic apoptotic pathway
N00453  HIV Vpr to intrinsic apoptotic pathway
N00474  EBV BHRF1 to intrinsic apoptotic pathway
N00475  EBV BHRF1 to intrinsic apoptotic pathway
N00476  EBV BHRF1 to intrinsic apoptotic pathway
N00477  EBV BHRF1 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00478  EBV BARF1 to intrinsic apoptotic pathway
N00481  EBV BZLF1 to p53-mediated transcription
 » show all
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    578 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    578 (BAK1)
   04215 Apoptosis - multiple species
    578 (BAK1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    578 (BAK1)
   05202 Transcriptional misregulation in cancer
    578 (BAK1)
   05206 MicroRNAs in cancer
    578 (BAK1)
   05203 Viral carcinogenesis
    578 (BAK1)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    578 (BAK1)
   05212 Pancreatic cancer
    578 (BAK1)
   05225 Hepatocellular carcinoma
    578 (BAK1)
   05226 Gastric cancer
    578 (BAK1)
   05214 Glioma
    578 (BAK1)
   05216 Thyroid cancer
    578 (BAK1)
   05220 Chronic myeloid leukemia
    578 (BAK1)
   05217 Basal cell carcinoma
    578 (BAK1)
   05218 Melanoma
    578 (BAK1)
   05213 Endometrial cancer
    578 (BAK1)
   05224 Breast cancer
    578 (BAK1)
   05222 Small cell lung cancer
    578 (BAK1)
   05223 Non-small cell lung cancer
    578 (BAK1)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    578 (BAK1)
   05163 Human cytomegalovirus infection
    578 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    578 (BAK1)
   05169 Epstein-Barr virus infection
    578 (BAK1)
   05165 Human papillomavirus infection
    578 (BAK1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    578 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    578 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    578 (BAK1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    578 (BAK1)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   578 (BAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 Bcl-2_3
Motif
Other DBs
NCBI-GeneID: 578
NCBI-ProteinID: NP_001179
OMIM: 600516
HGNC: 949
Ensembl: ENSG00000030110
Vega: OTTHUMG00000014530
Pharos: Q16611(Tbio)
UniProt: Q16611 A0A0S2Z391
Structure
PDB: 

Position
6p21.31
AA seq 211 aa AA seqDB search
MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEM
VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFE
SGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA
LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggggcaaggcccaggtcctcccaggcaggagtgcggagagcctgccctgccc
tctgcttctgaggagcaggtagcccaggacacagaggaggttttccgcagctacgttttt
taccgccatcagcaggaacaggaggctgaaggggtggctgcccctgccgacccagagatg
gtcaccttacctctgcaacctagcagcaccatggggcaggtgggacggcagctcgccatc
atcggggacgacatcaaccgacgctatgactcagagttccagaccatgttgcagcacctg
cagcccacggcagagaatgcctatgagtacttcaccaagattgccaccagcctgtttgag
agtggcatcaattggggccgtgtggtggctcttctgggcttcggctaccgtctggcccta
cacgtctaccagcatggcctgactggcttcctaggccaggtgacccgcttcgtggtcgac
ttcatgctgcatcactgcattgcccggtggattgcacagaggggtggctgggtggcagcc
ctgaacttgggcaatggtcccatcctgaacgtgctggtggttctgggtgtggttctgttg
ggccagtttgtggtacgaagattcttcaaatcatga

DBGET integrated database retrieval system