KEGG   Homo sapiens (human): 57801Help
Entry
57801             CDS       T01001                                 

Gene name
HES4, bHLHb42
Definition
(RefSeq) hes family bHLH transcription factor 4
  KO
K09089  hairy and enhancer of split 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    57801 (HES4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    57801 (HES4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hairy_orange HLH NPR3
Motif
Other DBs
NCBI-GeneID: 57801
NCBI-ProteinID: NP_066993
OMIM: 608060
HGNC: 24149
Ensembl: ENSG00000188290
Vega: OTTHUMG00000040758
Pharos: Q9HCC6(Tbio)
UniProt: Q9HCC6
Position
1p36.33
AA seq 221 aa AA seqDB search
MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKSSKPVMEKRRRARINESLAQLKTL
ILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGFHECLAE
VNRFLAGCEGVPADVRSRLLGHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLP
SLGGPFPLLAPPLLPGLTRALPAAPRAGPQGPGGPWRPWLR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagacacgccggggaaaccgagcgcctcgccgatggcaggagcgccggccagc
gccagccggaccccagacaagccccggagcgcggccgagcaccgcaagtcctccaagccg
gtcatggagaagcggcgccgagcgcgtattaacgagagcctcgctcagctcaaaaccctc
atcctggacgccctcagaaaagagagctcccgccactcgaagctggagaaggcggacatc
ctggagatgaccgtgagacacctgcggagcctgcgtcgcgtgcaggtgacggccgcgctc
agcgccgaccccgccgttctgggcaagtaccgcgccggcttccacgagtgtctggcggag
gtgaaccgcttcctggccggctgcgagggcgtcccggccgacgtgcgctcccgcctgctg
ggccacctggcagcctgcctgcgccagctgggaccctcccgccgcccggcctcgctgtcc
ccggctgcccccgcagaggccccagcgcccgaggtctacgcgggccgcccgctgctgcca
tcgctcggcggccccttccctctgctcgcgccgccgctgctgccgggtctgacccgggcg
ctgcccgccgcccccagggcggggccgcagggcccgggtgggccctggaggccgtggctg
cgctga

DBGET integrated database retrieval system