KEGG   Homo sapiens (human): 57804
Entry
57804             CDS       T01001                                 

Symbol
POLD4, POLDS, p12
Name
(RefSeq) DNA polymerase delta 4, accessory subunit
  KO
K03505  DNA polymerase delta subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03410  Base excision repair
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
hsa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    57804 (POLD4)
   03410 Base excision repair
    57804 (POLD4)
   03420 Nucleotide excision repair
    57804 (POLD4)
   03430 Mismatch repair
    57804 (POLD4)
   03440 Homologous recombination
    57804 (POLD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    57804 (POLD4)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    57804 (POLD4)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    57804 (POLD4)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      57804 (POLD4)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     57804 (POLD4)
SSDB
Motif
Pfam: DNA_pol_delta_4
Other DBs
NCBI-GeneID: 57804
NCBI-ProteinID: NP_066996
OMIM: 611525
HGNC: 14106
Ensembl: ENSG00000175482
Vega: OTTHUMG00000167135
Pharos: Q9HCU8(Tdark)
UniProt: Q9HCU8 A0A024R5D7 Q6NSD7
Position
11q13.2
AA seq 107 aa
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGP
CTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL
NT seq 324 nt   +upstreamnt  +downstreamnt
atgggccggaagcggctcatcactgattcctacccggttgtgaagaggagggaggggccc
gctgggcacagcaagggggagctggcacccgagctaggggaggagccccagccccgcgac
gaggaggaagcggagctggagctgctgaggcagtttgacctggcctggcagtacgggccc
tgcaccgggatcacacggctgcagcgctggtgtcgggccaagcagatgggcttggagcct
cccccagaggtgtggcaggtgctgaagacccaccccggagacccccgcttccagtgcagt
ctctggcatctctatcccctatga

DBGET integrated database retrieval system