KEGG   Homo sapiens (human): 57805Help
Entry
57805             CDS       T01001                                 

Gene name
CCAR2, DBC-1, DBC1, KIAA1967, NET35, p30_DBC, p30DBC
Definition
(RefSeq) cell cycle and apoptosis regulator 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DBC1 S1-like EKLF_TAD1 KASH_CCD ADIP BLOC1_2
Motif
Other DBs
NCBI-GeneID: 57805
NCBI-ProteinID: NP_066997
OMIM: 607359
HGNC: 23360
Ensembl: ENSG00000158941
Vega: OTTHUMG00000162249
Pharos: Q8N163(Tbio)
UniProt: Q8N163
Position
8p21.3
AA seq 923 aa AA seqDB search
MSQFKRQRINPLPGGRNFSGTASTSLLGPPPGLLTPPVATELSQNARHLQGGEKQRVFTG
IVTSLHDYFGVVDEEVFFQLSVVKGRLPQLGEKVLVKAAYNPGQAVPWNAVKVQTLSNQP
LLKSPAPPLLHVAALGQKQGILGAQPQLIFQPHRIPPLFPQKPLSLFQTSHTLHLSHLNR
FPARGPHGRLDQGRSDDYDSKKRKQRAGGEPWGAKKPRHDLPPYRVHLTPYTVDSPICDF
LELQRRYRSLLVPSDFLSVHLSWLSAFPLSQPFSLHHPSRIQVSSEKEAAPDAGAEPITA
DSDPAYSSKVLLLSSPGLEELYRCCMLFVDDMAEPRETPEHPLKQIKFLLGRKEEEAVLV
GGEWSPSLDGLDPQADPQVLVRTAIRCAQAQTGIDLSGCTKWWRFAEFQYLQPGPPRRLQ
TVVVYLPDVWTIMPTLEEWEALCQQKAAEAAPPTQEAQGETEPTEQAPDALEQAADTSRR
NAETPEATTQQETDTDLPEAPPPPLEPAVIARPGCVNLSLHGIVEDRRPKERISFEVMVL
AELFLEMLQRDFGYRVYKMLLSLPEKVVSPPEPEKEEAAKEEATKEEEAIKEEVVKEPKD
EAQNEGPATESEAPLKEDGLLPKPLSSGGEEEEKPRGEASEDLCEMALDPELLLLRDDGE
EEFAGAKLEDSEVRSVASNQSEMEFSSLQDMPKELDPSAVLPLDCLLAFVFFDANWCGYL
HRRDLERILLTLGIRLSAEQAKQLVSRVVTQNICQYRSLQYSRQEGLDGGLPEEVLFGNL
DLLPPPGKSTKPGAAPTEHKALVSHNGSLINVGSLLQRAEQQDSGRLYLENKIHTLELKL
EESHNRFSATEVTNKTLAAEMQELRVRLAEAEETARTAERQKSQLQRLLQELRRRLTPLQ
LEIQRVVEKADSWVEKEEPAPSN
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagtttaagcgccagcggatcaacccgcttccagggggacgcaacttctcaggc
acagcttcaacatctcttctgggccctcctcctggtttgctcactcctcctgtggccaca
gaactgtcccagaatgccaggcaccttcagggtggggagaaacagcgggtcttcactggt
attgttaccagcttgcatgactactttggggttgtggatgaagaggtcttttttcagcta
agtgtggtgaagggccgtctgccccagctgggtgagaaggtgctggtgaaggctgcatac
aacccaggccaggcagtgccctggaatgctgtcaaggtgcaaacgctctccaaccagccc
ctactgaagtccccagcacctcctcttctgcatgtagcagccctgggccagaagcaaggg
atcctgggagctcagcctcagttgatcttccagcctcaccggattcccccactctttcct
cagaagcctctgagtctcttccaaacatcccacacacttcacctgagccacctgaacaga
tttcctgcccggggccctcatggacggttggatcagggccgaagtgatgactatgactcc
aagaaacgcaaacagcgggctggtggagagccctggggtgctaagaagccaaggcatgac
ctgcctccttaccgggtccacctcactccttacactgtggacagccccatctgtgacttc
ctagaactccagcgccgttaccgcagcctcctggtcccctcagattttctgtccgtgcat
ctgagttggctatcagccttccccctgagccagcccttttccctccatcatccaagccgg
atccaggtctcttctgaaaaggaggcagctccagacgctggtgctgagcccatcactgca
gacagtgaccccgcttatagttcgaaggtactgctgctctcttccccggggttggaggaa
ttgtatcgttgttgcatgctctttgtggatgacatggctgagccaagggagacgccagag
catcctctgaagcagattaagtttttgctgggcaggaaagaagaggaggcagtgctggtt
gggggtgaatggtctccttccctggatggcctcgacccccaggctgacccgcaggtgctg
gtgcgtaccgccatccgctgtgcgcaggcccagactggcattgatttgagcggctgtacc
aagtggtggcgctttgccgagtttcagtacctgcagccgggacccccccggcggcttcag
acagtggtggtgtacctgccggatgtctggaccatcatgcctactttggaggagtgggag
gccctgtgccagcagaaagctgcagaggcagctcccccaacccaggaggcacaaggggaa
acggagcctactgaacaggcacctgatgccttggagcaagcagcagacacttctagacgg
aacgcagaaactccagaggccaccacacagcaggaaacggacactgatctcccagaggcc
cctccaccccccctagaacctgctgtcatcgcacgccctggctgtgtaaacctgtccctc
catgggattgtggaggatcggaggccaaaggaaaggatctcttttgaggtgatggtgctg
gccgagctgtttctggagatgctccagagggattttggctatagagtttataagatgcta
ctgagccttcctgaaaaggtcgtgtccccacctgaacctgagaaggaggaggcggccaag
gaagaagccaccaaggaggaagaagccatcaaagaggaggtggtcaaggagcccaaggat
gaggcacagaatgagggcccggctacagagtcagaggccccgctgaaggaggatgggctt
ttgcccaaaccactctcttctgggggagaggaagaagaaaaaccccggggcgaggcttct
gaggacctgtgtgagatggccctggacccagaactgttgcttctgagggatgatggagag
gaggagtttgcaggagcaaagctggaggattcggaggtccggtccgttgcctcaaaccag
tcagagatggagttctcttcacttcaggacatgcccaaggagctggatccctctgctgtg
ctccccttagactgtctgcttgcttttgtgttctttgatgccaactggtgtggctacttg
caccggcgagacttagagaggatcctccttacccttgggatccggctcagtgcagagcag
gccaagcagctggtcagcagggtggtgacccagaacatctgccagtaccggagccttcag
tacagccgccaggagggcctggatggtggccttcccgaggaggtgctcttcggaaacctg
gacctgctgccccctcctgggaaaagcacgaagccaggtgctgcccccacagaacacaaa
gccttggtgtcccacaatggcagcctgattaacgtggggagcctgctgcagcgcgcggag
cagcaggacagcggccggctctacctagagaacaagatccacacactggagctgaagctg
gaggagagccataaccgtttctcagccactgaagtaaccaataagacgctggcggcagag
atgcaggagctgcgagtccggctggcggaggccgaggagaccgcccggacggcggagcga
cagaagagccagctccagcggctgctgcaggagctccgcaggcgtctgacccccctgcag
ctggagatccagcgggtggtggaaaaggctgacagctgggtggagaaggaggagccggca
cctagcaactga

DBGET integrated database retrieval system