KEGG   Homo sapiens (human): 57817
Entry
57817             CDS       T01001                                 

Gene name
HAMP, HEPC, HFE2B, LEAP1, PLTR
Definition
(RefSeq) hepcidin antimicrobial peptide
  KO
K23106  hepcidin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
Disease
H00211  Hemochromatosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    57817 (HAMP)
SSDB
Motif
Pfam: Hepcidin
Other DBs
NCBI-GeneID: 57817
NCBI-ProteinID: NP_066998
OMIM: 606464
HGNC: 15598
Ensembl: ENSG00000105697
Vega: OTTHUMG00000183295
Pharos: P81172(Tbio)
UniProt: P81172
Structure
PDB: 
3H0T 4QAE 2KEF

Position
19q13.12
AA seq 84 aa
MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRD
THFPICIFCCGCCHRSKCGMCCKT
NT seq 255 nt   +upstreamnt  +downstreamnt
atggcactgagctcccagatctgggccgcttgcctcctgctcctcctcctcctcgccagc
ctgaccagtggctctgttttcccacaacagacgggacaacttgcagagctgcaaccccag
gacagagctggagccagggccagctggatgcccatgttccagaggcgaaggaggcgagac
acccacttccccatctgcattttctgctgcggctgctgtcatcgatcaaagtgtgggatg
tgctgcaagacgtag

DBGET integrated database retrieval system