KEGG   Homo sapiens (human): 57819
Entry
57819             CDS       T01001                                 

Gene name
LSM2, C6orf28, G7B, YBL026W, snRNP
Definition
(RefSeq) LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated
  KO
K12621  U6 snRNA-associated Sm-like protein LSm2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    57819 (LSM2)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    57819 (LSM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    57819 (LSM2)
   03041 Spliceosome [BR:hsa03041]
    57819 (LSM2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     57819 (LSM2)
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     57819 (LSM2)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    57819 (LSM2)
 Complex C
  U2 snRNP components
    57819 (LSM2)
SSDB
Motif
Pfam: LSM SM-ATX
Other DBs
NCBI-GeneID: 57819
NCBI-ProteinID: NP_067000
OMIM: 607282
HGNC: 13940
Ensembl: ENSG00000204392
Vega: OTTHUMG00000031121
Pharos: Q9Y333(Tbio)
UniProt: Q9Y333
Structure
PDB: 
5O9Z 6AH0 3JCR

Position
6p21.33
AA seq 95 aa
MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNC
FIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
NT seq 288 nt   +upstreamnt  +downstreamnt
atgctcttctattcttttttcaagtcccttgtgggcaaggatgtggtcgtggaactaaag
aatgacctgagcatctgtggaaccctccattctgtggatcagtatctcaacatcaaacta
actgacatcagtgtcacagaccctgagaaataccctcacatgttatcagtgaagaactgc
ttcattcggggctcagtggtccgatacgtgcagctgccagcagatgaggtcgacacacag
ttgctacaggatgcggcaaggaaggaagccctgcagcagaaacagtga

DBGET integrated database retrieval system