KEGG   Homo sapiens (human): 57820
Entry
57820             CDS       T01001                                 

Gene name
CCNB1IP1, C14orf18, HEI10
Definition
(RefSeq) cyclin B1 interacting protein 1
  KO
K10639  E3 ubiquitin-protein ligase CCNP1IP1 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    57820 (CCNB1IP1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     57820 (CCNB1IP1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    57820 (CCNB1IP1)
SSDB
Motif
Pfam: zf-RING_5 MAD DUF4201 ATG16 DUF730 HIP1_clath_bdg OmpH
Other DBs
NCBI-GeneID: 57820
NCBI-ProteinID: NP_067001
OMIM: 608249
HGNC: 19437
Ensembl: ENSG00000100814
Vega: OTTHUMG00000029509
Pharos: Q9NPC3(Tbio)
UniProt: Q9NPC3 A0A384MR52
Position
14q11.2
AA seq 277 aa
MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLD
IVRTELSPSEEYKAMVLAGLRPEIVLDISSRALAFWTYQVHQERLYQEYNFSKAEGHLKQ
MEKIYTQQIQSKDVELTSMKGEVTSMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDS
LRLRNITIANHEGTLEPSMIAQSGVLGFPLGNNSKFPLDNTPVRNRGDGDGDFQFRPFFA
GSPTAPEPSNSFFSFVSPSRELEQQQVSSRAFKVKRI
NT seq 834 nt   +upstreamnt  +downstreamnt
atgtctttgtgtgaagacatgctgctttgtaattatcgaaagtgtcgcatcaaactctct
ggctatgcatgggtcactgcctgctctcacatcttctgtgatcagcatggcagtggtgag
tttagtcgctcaccagctatctgtcctgcctgcaacagtaccctttctggaaagctagat
attgtccgcacagaactcagtccatcagaggaatataaagctatggtattggcaggactg
cgaccagagatcgtgttggacattagctcccgagcgctggccttctggacatatcaggta
catcaggaacgtctctatcaagaatacaatttcagcaaggctgagggccatctgaaacag
atggagaagatatatactcagcaaatacaaagcaaggatgtagaattgacctctatgaaa
ggggaggttacctccatgaagaaagtactagaagaatacaagaaaaagttcagtgacatc
tctgagaaacttatggagcgcaatcgtcagtatcaaaagctccaaggcctctatgatagc
cttaggctacgaaacatcactattgctaaccatgaaggcacccttgaaccatccatgatt
gcacagtctggtgttcttggcttcccattaggtaacaactccaagtttcctttggataat
acacctgttcgaaatcggggcgatggagatggagattttcagttcagaccattttttgcg
ggttctcccacagcacctgaacccagcaacagcttttttagttttgtctctccaagtcgt
gaattagagcagcagcaagtttctagcagggccttcaaagtaaaaagaatttga

DBGET integrated database retrieval system