KEGG   Homo sapiens (human): 57821
Entry
57821             CDS       T01001                                 
Symbol
CCDC181, C1orf114
Name
(RefSeq) coiled-coil domain containing 181
  KO
K25625  coiled-coil domain-containing protein 181
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    57821 (CCDC181)
Cilium and associated proteins [BR:hsa03037]
 Motile cilia and associated proteins
  Sperm flagellum proteins
   57821 (CCDC181)
SSDB
Motif
Pfam: CCDC34
Other DBs
NCBI-GeneID: 57821
NCBI-ProteinID: NP_001287898
HGNC: 28051
Ensembl: ENSG00000117477
Pharos: Q5TID7(Tdark)
UniProt: Q5TID7
Position
1:complement(169394870..169460669)
AA seq 509 aa
MNENKDTDSKKSEEYEDDFEKDLEWLINENEKSDASIIEMACEKEENINQDLKENETVME
HTKRHSDPDKSLQDEVSPRRNDIISVPGIQPLDPISDSDSENSFQESKLESQKDLEEEED
EEVRRYIMEKIVQANKLLQNQEPVNDKRERKLKFKDQLVDLEVPPLEDTTTFKNYFENER
NMFGKLSQLCISNDFGQEDVLLSLTNGSCEENKDRTILVERDGKFELLNLQDIASQGFLP
PINNANSTENDPQQLLPRSSNSSVSGTKKEDSTAKIHAVTHSSTGEPLAYIAQPPLNRKT
CPSSAVNSDRSKGNGKSNHRTQSAHISPVTSTYCLSPRQKELQKQLEEKREKLKREEERR
KIEEEKEKKRENDIVFKAWLQKKREQVLEMRRIQRAKEIEDMNSRQENRDPQQAFRLWLK
KKHEEQMKERQTEELRKQEECLFFLKGTEGRERAFKQWLRRKRMEKMAEQQAVRERTRQL
RLEAKRSKQLQHHLYMSEAKPFRFTDHYN
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgaatgaaaataaagatactgattcaaagaaaagtgaagaatacgaagatgactttgaa
aaggacctggagtggttaattaatgaaaatgaaaaaagtgatgccagcataatagagatg
gcttgtgagaaggaagagaatattaaccaagacttaaaagagaatgagacagtaatggag
cacaccaaacggcattctgatcctgacaaatctttgcaggatgaggtctcaccaagaaga
aatgacatcatttctgtaccaggtattcaacctttggatcccatatcagattcagatagt
gaaaactctttccaggaatccaaactagaaagccagaaagacttggaggaggaagaggat
gaggaagtaaggagatatattatggagaaaattgtacaagctaacaagcttctacagaat
caagaaccggtgaatgataaaagggagcgaaaacttaagttcaaggaccagttagttgat
ttggaagttcctccactagaagacactactacttttaaaaattattttgaaaacgaaagg
aatatgtttgggaaactgtcacaattatgtatttccaatgattttggacaagaagatgtg
ctcctgtcacttactaatggaagctgtgaagaaaacaaggataggacaatactggtagag
agagatggaaaatttgaacttctgaatttacaagacattgccagtcaggggtttttgcct
cccattaataatgcaaatagtacagaaaatgaccctcagcagttgttacccagatcttcc
aactcctctgtcagtggcaccaagaaagaagattctacagcaaagattcatgctgtcact
cactcatcaacaggagagccgctggcttatatcgctcagccaccactcaaccgcaagact
tgtccaagctctgctgtcaactcagatcgaagtaaagggaatgggaaatctaatcacagg
acacagtctgcacatatctcaccagtgacttcaacatactgtctttcccctcgacagaaa
gaactacaaaaacaactagaagaaaagagagaaaaactgaaaagagaggaagagcgacga
aaaatagaagaagagaaagaaaaaaagagagagaatgacatagtatttaaagcgtggttg
caaaagaaaagagagcaggtcttagaaatgaggagaattcagcgagcaaaggaaattgaa
gacatgaacagtagacaggaaaacagagatccacaacaagcttttcgattatggcttaaa
aaaaagcacgaagagcagatgaaagaaagacagacagaagaactaagaaagcaagaggaa
tgtttattcttccttaaaggaacagaaggccgggaaagggcctttaaacaatggttaaga
aggaaacggatggaaaaaatggcagagcaacaagctgtcagagagagaactagacagctc
cgactagaagctaagcgttctaaacagttacagcaccacctatatatgtcagaagccaaa
ccttttcgttttactgatcattataactga

DBGET integrated database retrieval system