KEGG   Homo sapiens (human): 57822
Entry
57822             CDS       T01001                                 

Gene name
GRHL3, SOM, TFCP2L4, VWS2
Definition
(RefSeq) grainyhead like transcription factor 3
  KO
K09275  transcription factor CP2 and related proteins
Organism
hsa  Homo sapiens (human)
Disease
H01927  Van der Woude syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    57822 (GRHL3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Grainyhead
    57822 (GRHL3)
SSDB
Motif
Pfam: CP2
Other DBs
NCBI-GeneID: 57822
NCBI-ProteinID: NP_937817
OMIM: 608317
HGNC: 25839
Ensembl: ENSG00000158055
Vega: OTTHUMG00000003040
Pharos: Q8TE85(Tbio)
UniProt: Q8TE85
Position
1p36.11
AA seq 626 aa
MSNELDFRSVRLLKNDPVNLQKFSYTSEDEAWKTYLENPLTAATKAMMRVNGDDDSVAAL
SFLYDYYMGPKEKRILSSSTGGRNDQGKRYYHGMEYETDLTPLESPTHLMKFLTENVSGT
PEYPDLLKKNNLMSLEGALPTPGKAAPLPAGPSKLEAGSVDSYLLPTTDMYDNGSLNSLF
ESIHGVPPTQRWQPDSTFKDDPQESMLFPDILKTSPEPPCPEDYPSLKSDFEYTLGSPKA
IHIKSGESPMAYLNKGQFYPVTLRTPAGGKGLALSSNKVKSVVMVVFDNEKVPVEQLRFW
KHWHSRQPTAKQRVIDVADCKENFNTVEHIEEVAYNALSFVWNVNEEAKVFIGVNCLSTD
FSSQKGVKGVPLNLQIDTYDCGLGTERLVHRAVCQIKIFCDKGAERKMRDDERKQFRRKV
KCPDSSNSGVKGCLLSGFRGNETTYLRPETDLETPPVLFIPNVHFSSLQRSGGAAPSAGP
SSSNRLPLKRTCSPFTEEFEPLPSKQAKEGDLQRVLLYVRRETEEVFDALMLKTPDLKGL
RNAISEKYGFPEENIYKVYKKCKRGETSLLHPRLSRHPPPDCLECSHPVTQVRNMGFGDG
FWRQRDLDSNPSPTTVNSLHFTVNSE
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgtcgaatgaacttgatttcaggtctgtgcggctgctaaagaacgacccagtcaacttg
cagaaattctcttacactagtgaggatgaggcctggaagacgtacctagaaaacccgttg
acagctgccacaaaggccatgatgagagtcaatggagatgatgacagtgttgcggccttg
agcttcctctatgattactacatgggtcccaaggagaagcggatattgtcctccagcact
gggggcaggaatgaccaaggaaagaggtactaccatggcatggaatatgagacggacctc
actccccttgaaagccccacacacctcatgaaattcctgacagagaacgtgtctggaacc
ccagagtacccagatttgctcaagaagaataacctgatgagcttggagggggccttgccc
acccctggcaaggcagctcccctccctgcaggccccagcaagctggaggccggctctgtg
gacagctacctgttacccaccactgatatgtatgataatggctccctcaactccttgttt
gagagcattcatggggtgccgcccacacagcgctggcagccagacagcaccttcaaagat
gacccacaggagtcgatgctcttcccagatatcctgaaaacctccccggaacccccatgt
ccagaggactaccccagcctcaaaagtgactttgaatacaccctgggctcccccaaagcc
atccacatcaagtcaggcgagtcacccatggcctacctcaacaaaggccagttctacccc
gtcaccctgcggaccccagcaggtggcaaaggccttgccttgtcctccaacaaagtcaag
agtgtggtgatggttgtcttcgacaatgagaaggtcccagtagagcagctgcgcttctgg
aagcactggcattcccggcaacccactgccaagcagcgggtcattgacgtggctgactgc
aaagaaaacttcaacactgtggagcacattgaggaggtggcctataatgcactgtccttt
gtgtggaacgtgaatgaagaggccaaggtgttcatcggcgtaaactgtctgagcacagac
ttttcctcacaaaagggggtgaagggtgtccccctgaacctgcagattgacacctatgac
tgtggcttgggcactgagcgcctggtacaccgtgctgtctgccagatcaagatcttctgt
gacaagggagctgagaggaagatgcgcgatgacgagcggaagcagttccggaggaaggtc
aagtgccctgactccagcaacagtggcgtcaagggctgcctgctgtcgggcttcaggggc
aatgagacgacctaccttcggccagagactgacctggagacgccacccgtgctgttcatc
cccaatgtgcacttctccagcctgcagcgctctggaggggcagccccctcggcaggaccc
agcagctccaacaggctgcctctgaagcgtacctgctcgcccttcactgaggagtttgag
cctctgccctccaagcaggccaaggaaggcgaccttcagagagttctgctgtatgtgcgg
agggagactgaggaggtgtttgacgcgctcatgttgaagaccccagacctgaaggggctg
aggaatgcgatctctgagaagtatgggttccctgaagagaacatttacaaagtctacaag
aaatgcaagcgaggggaaacttctctcctccacccacgcctgtctcgccaccccccacct
gactgtcttgaatgttcccatcctgtgactcaagtgaggaacatgggttttggagatgga
ttttggaggcagagggacctggattcaaatcccagccccaccaccgtcaacagcctgcac
ttcactgtaaactcggaatga

DBGET integrated database retrieval system