KEGG   Homo sapiens (human): 5783Help
Entry
5783              CDS       T01001                                 

Gene name
PTPN13, FAP-1, PNP1, PTP-BAS, PTP-BL, PTP1E, PTPL1, PTPLE, hPTP1E
Definition
(RefSeq) protein tyrosine phosphatase non-receptor type 13
  KO
K02374  tyrosine-protein phosphatase non-receptor type 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    5783 (PTPN13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5783 (PTPN13)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    5783 (PTPN13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ Y_phosphatase PTN13_u3 PDZ_6 FERM_M PDZ_2 FERM_C FERM_N KIND DSPc PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 5783
NCBI-ProteinID: NP_542414
OMIM: 600267
HGNC: 9646
Ensembl: ENSG00000163629
Vega: OTTHUMG00000160968
Pharos: Q12923(Tchem)
UniProt: Q12923
Structure
PDB: 

Position
4q21.3
AA seq 2485 aa AA seqDB search
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLADPAALGFIISPWSLLLLP
SGSVSFTDENISNQDLRAFTAPEVLQNQSLTSLSDVEKIHIYSLGMTLYWGADYEVPQSQ
PIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
SGTDQLSCNSEQKPDRSQAIRDRLRGKGLPTGRSSTSDVLDIQKPPLSHQTFLNKGLSKS
MGFLSIKDTQDENYFKDILSDNSGREDSENTFSPYQFKTSGPEKKPIPGIDVLSKKKIWA
SSMDLLCTADRDFSSGETATYRRCHPEAVTVRTSTTPRKKEARYSDGSIALDIFGPQKMD
PIYHTRELPTSSAISSALDRIRERQKKLQVLREAMNVEEPVRRYKTYHGDVFSTSSESPS
IISSESDFRQVRRSEASKRFESSSGLPGVDETLSQGQSQRPSRQYETPFEGNLINQEIML
KRQEEELMQLQAKMALRQSRLSLYPGDTIKASMLDITRDPLREIALETAMTQRKLRNFFG
PEFVKMTIEPFISLDLPRSILTKKGKNEDNRRKVNIMLLNGQRLELTCDTKTICKDVFDM
VVAHIGLVEHHLFALATLKDNEYFFVDPDLKLTKVAPEGWKEEPKKKTKATVNFTLFFRI
KFFMDDVSLIQHTLTCHQYYLQLRKDILEERMHCDDETSLLLASLALQAEYGDYQPEVHG
VSYFRMEHYLPARVMEKLDLSYIKEELPKLHNTYVGASEKETELEFLKVCQRLTEYGVHF
HRVHPEKKSQTGILLGVCSKGVLVFEVHNGVRTLVLRFPWRETKKISFSKKKITLQNTSD
GIKHGFQTDNSKICQYLLHLCSYQHKFQLQMRARQSNQDAQDIERASFRSLNLQAESVRG
FNMGRAISTGSLASSTLNKLAVRPLSVQAEILKRLSCSELSLYQPLQNSSKEKNDKASWE
EKPREMSKSYHDLSQASLYPHRKNVIVNMEPPPQTVAELVGKPSHQMSRSDAESLAGVTK
LNNSKSVASLNRSPERRKHESDSSSIEDPGQAYVLGMTMHSSGNSSSQVPLKENDVLHKR
WSIVSSPEREITLVNLKKDAKYGLGFQIIGGEKMGRLDLGIFISSVAPGGPADLDGCLKP
GDRLISVNSVSLEGVSHHAAIEILQNAPEDVTLVISQPKEKISKVPSTPVHLTNEMKNYM
KKSSYMQDSAIDSSSKDHHWSRGTLRHISENSFGPSGGLREGSLSSQDSRTESASLSQSQ
VNGFFASHLGDQTWQESQHGSPSPSVISKATEKETFTDSNQSKTKKPGISDVTDYSDRGD
SDMDEATYSSSQDHQTPKQESSSSVNTSNKMNFKTFSSSPPKPGDIFEVELAKNDNSLGI
SVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRN
TGQVVHLLLEKGQSPTSKEHVPVTPQCTLSDQNAQGQGPEKVKKTTQVKDYSFVTEENTF
EVKLFKNSSGLGFSFSREDNLIPEQINASIVRVKKLFPGQPAAESGKIDVGDVILKVNGA
SLKGLSQQEVISALRGTAPEVFLLLCRPPPGVLPEIDTALLTPLQSPAQVLPNSSKDSSQ
PSCVEQSTSSDENEMSDKSKKQCKSPSRRDSYSDSSGSGEDDLVTAPANISNSTWSSALH
QTLSNMVSQAQSHHEAPKSQEDTICTMFYYPQKIPNKPEFEDSNPSPLPPDMAPGQSYQP
QSESASSSSMDKYHIHHISEPTRQENWTPLKNDLENHLEDFELEVELLITLIKSEKGSLG
FTVTKGNQRIGCYVHDVIQDPAKSDGRLKPGDRLIKVNDTDVTNMTHTDAVNLLRAASKT
VRLVIGRVLELPRIPMLPHLLPDITLTCNKEELGFSLCGGHDSLYQVVYISDINPRSVAA
IEGNLQLLDVIHYVNGVSTQGMTLEEVNRALDMSLPSLVLKATRNDLPVVPSSKRSAVSA
PKSTKGNGSYSVGSCSQPALTPNDSFSTVAGEEINEISYPKGKCSTYQIKGSPNLTLPKE
SYIQEDDIYDDSQEAEVIQSLLDVVDEEAQNLLNENNAAGYSCGPGTLKMNGKLSEERTE
DTDCDGSPLPEYFTEATKMNGCEEYCEEKVKSESLIQKPQEKKTDDDEITWGNDELPIER
TNHEDSDKDHSFLTNDELAVLPVVKVLPSGKYTGANLKSVIRVLRGLLDQGIPSKELENL
QELKPLDQCLIGQTKENRRKNRYKNILPYDATRVPLGDEGGYINASFIKIPVGKEEFVYI
ACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRYWPNILGKTTMVSNRLRLA
LVRMQQLKGFVVRAMTLEDIQTREVRHISHLNFTAWPDHDTPSQPDDLLTFISYMRHIHR
SGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQTEDQYIFC
YQVILYVLTRLQAEEEQKQQPQLLK
NT seq 7458 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgtcactagctgaggccctggaggttcggggtggaccacttcaggaggaagaa
atatgggctgtattaaatcaaagtgctgaaagtctccaagaattattcagaaaagtaagc
ctagctgatcctgctgcccttggcttcatcatttctccatggtctctgctgttgctgcca
tctggtagtgtgtcatttacagatgaaaatatttccaatcaggatcttcgagcattcact
gcaccagaggttcttcaaaatcagtcactaacttctctctcagatgttgaaaagatccac
atttattctcttggaatgacactgtattggggggctgattatgaagtgcctcagagccaa
cctattaagcttggagatcatctcaacagcatactgcttggaatgtgtgaggatgttatt
tacgctcgagtttctgttcggactgtgctggatgcttgcagtgcccacattaggaatagc
aattgtgcaccctcattttcctacgtgaaacacttggtaaaactggttctgggaaatctt
tctgggacagatcagctttcctgtaacagtgaacaaaagcctgatcgaagccaggctatt
cgagatcgattgcgaggaaaaggattaccaacaggaagaagctctacttctgatgtacta
gacatacaaaagcctccactctctcatcagacctttcttaacaaagggcttagtaaatct
atgggatttctgtccatcaaagatacacaagatgagaattatttcaaggacattttatca
gataattctggacgtgaagattctgaaaatacattctccccttaccagttcaaaactagt
ggcccagaaaaaaaacccatccctggcattgatgtgctttctaagaagaagatctgggct
tcatccatggacttgctttgtacagctgacagagacttctcttcaggagagactgccaca
tatcgtcgttgtcaccctgaggcagtaacagtgcggacttcaactactcctagaaaaaag
gaggcaagatactcagatggaagtatagccttggatatctttggccctcagaaaatggat
ccaatatatcacactcgagaattgcccacctcctcagcaatatcaagtgctttggaccga
atccgagagagacaaaagaaacttcaggttctgagggaagccatgaatgtagaagaacca
gttcgaagatacaaaacttatcatggtgatgtctttagtacctccagtgaaagtccatct
attatttcctctgaatcagatttcagacaagtgagaagaagtgaagcctcaaagaggttt
gaatccagcagtggtctcccaggggtagatgaaaccttaagtcaaggccagtcacagaga
ccgagcagacaatatgaaacaccctttgaaggcaacttaattaatcaagagatcatgcta
aaacggcaagaggaagaactgatgcagctacaagccaaaatggcccttagacagtctcgg
ttgagcctatatccaggagacacaatcaaagcgtccatgcttgacatcaccagggatccg
ttaagagaaattgccctagaaacagccatgactcaaagaaaactgaggaatttctttggc
cctgagtttgtgaaaatgacaattgaaccatttatatctttggatttgccacggtctatt
cttactaagaaagggaagaatgaggataaccgaaggaaagtaaacataatgcttctgaac
gggcaaagactggaactgacctgtgataccaaaactatatgtaaagatgtgtttgatatg
gttgtggcacatattggcttagtagagcatcatttgtttgctttagctaccctcaaagat
aatgaatatttctttgttgatcctgacttaaaattaaccaaagtggccccagagggatgg
aaagaagaaccaaagaaaaagaccaaagccactgttaattttactttgtttttcagaatt
aaattttttatggatgatgttagtctaatacaacatactctgacgtgtcatcagtattac
cttcagcttcgaaaagatattttggaggaaaggatgcactgtgatgatgagacttcctta
ttgctggcatccttggctctccaggctgagtatggagattatcaaccagaggttcatggt
gtgtcttactttagaatggagcactatttgcccgccagagtgatggagaaacttgattta
tcctatatcaaagaagagttacccaaattgcataatacctatgtgggagcttctgaaaaa
gagacagagttagaatttttaaaggtctgccaaagactgacagaatatggagttcatttt
caccgagtgcaccctgagaagaagtcacaaacaggaatattgcttggagtctgttctaaa
ggtgtccttgtgtttgaagttcacaatggagtgcgcacattggtccttcgctttccatgg
agggaaaccaagaaaatatctttttctaaaaagaaaatcacattgcaaaatacatcagat
ggaataaaacatggcttccagacagacaacagtaagatatgccagtacctgctgcacctc
tgctcttaccagcataagttccagctacagatgagagcaagacagagcaaccaagatgcc
caagatattgagagagcttcgtttaggagcctgaatctccaagcagagtctgttagagga
tttaatatgggacgagcaatcagcactggcagtctggccagcagcaccctcaacaaactt
gctgttcgacctttatcagttcaagctgagattctgaagaggctatcctgctcagagctg
tcgctttaccagccattgcaaaacagttcaaaagagaagaatgacaaagcttcatgggag
gaaaagcctagagagatgagtaaatcataccatgatctcagtcaggcctctctctatcca
catcggaaaaatgtcattgttaacatggaacccccaccacaaaccgttgcagagttggtg
ggaaaaccttctcaccagatgtcaagatctgatgcagaatctttggcaggagtgacaaaa
cttaataattcaaagtctgttgcgagtttaaatagaagtcctgaaaggaggaaacatgaa
tcagactcctcatccattgaagaccctgggcaagcatatgttctaggaatgactatgcat
agttctggaaactcttcatcccaagtacccttaaaagaaaatgatgtgctacacaaaaga
tggagcatagtatcttcaccagaaagggagatcaccttagtgaacctgaaaaaagatgca
aagtatggcttgggatttcaaattattggtggggagaagatgggaagactggacctaggc
atatttatcagttcagttgcccctggaggaccagctgacttggatggatgcttgaagcca
ggagaccgtttgatatctgtgaatagtgtgagtctggagggagtcagccaccatgctgca
attgaaattttgcaaaatgcacctgaagatgtgacacttgttatctctcagccaaaagaa
aagatatccaaagtgccttctactcctgtgcatctcaccaatgagatgaaaaactacatg
aagaaatcttcctacatgcaagacagtgctatagattcttcttccaaggatcaccactgg
tcacgtggtaccctgaggcacatctcggagaactcctttgggccatctgggggcctgcgg
gaaggaagcctgagttctcaagattccaggactgagagtgccagcttgtctcaaagccag
gtcaatggtttctttgccagccatttaggtgaccaaacctggcaggaatcacagcatggc
agcccttccccatctgtaatatccaaagccaccgagaaagagactttcactgatagtaac
caaagcaaaactaaaaagccaggcatttctgatgtaactgattactcagaccgtggagat
tcagacatggatgaagccacttactccagcagtcaggatcatcaaacaccaaaacaggaa
tcttcctcttcagtgaatacatccaacaagatgaattttaaaactttttcttcatcacct
cctaagcctggagatatctttgaggttgaactggctaaaaatgataacagcttggggata
agtgtcacgggaggtgtgaatacgagtgtcagacatggtggcatttatgtgaaagctgtt
attccccagggagcagcagagtctgatggtagaattcacaaaggtgatcgcgtcctagct
gtcaatggagttagtctagaaggagccacccataagcaagctgtggaaacactgagaaat
acaggacaggtggttcatctgttattagaaaagggacaatctccaacatctaaagaacat
gtcccggtaaccccacagtgtaccctttcagatcagaatgcccaaggtcaaggcccagaa
aaagtgaagaaaacaactcaggtcaaagactacagctttgtcactgaagaaaatacattt
gaggtaaaattatttaaaaatagctcaggtctaggattcagtttttctcgagaagataat
cttataccggagcaaattaatgccagcatagtaagggttaaaaagctctttcctggacag
ccagcagcagaaagtggaaaaattgatgtaggagatgttatcttgaaagtgaatggagcc
tctttgaaaggactatctcagcaggaagtcatatctgctctcaggggaactgctccagaa
gtattcttgcttctctgcagacctccacctggtgtgctaccggaaattgatactgcgctt
ttgaccccacttcagtctccagcacaagtacttccaaacagcagtaaagactcttctcag
ccatcatgtgtggagcaaagcaccagctcagatgaaaatgaaatgtcagacaaaagcaaa
aaacagtgcaagtccccatccagaagagacagttacagtgacagcagtgggagtggagaa
gatgacttagtgacagctccagcaaacatatcaaattcgacctggagttcagctttgcat
cagactctaagcaacatggtatcacaggcacagagtcatcatgaagcacccaagagtcaa
gaagataccatttgtaccatgttttactatcctcagaaaattcccaataaaccagagttt
gaggacagtaatccttcccctctaccaccggatatggctcctgggcagagttatcaaccc
caatcagaatctgcttcctctagttcgatggataagtatcatatacatcacatttctgaa
ccaactagacaagaaaactggacacctttgaaaaatgacttggaaaatcaccttgaagac
tttgaactggaagtagaactcctcattaccctaattaaatcagaaaaaggaagcctgggt
tttacagtaaccaaaggcaatcagagaattggttgttatgttcatgatgtcatacaggat
ccagccaaaagtgatggaaggctaaaacctggggaccggctcataaaggttaatgataca
gatgttactaatatgactcatacagatgcagttaatctgctccgggctgcatccaaaaca
gtcagattagttattggacgagttctagaattacccagaataccaatgttgcctcatttg
ctaccggacataacactaacgtgcaacaaagaggagttgggtttttccttatgtggaggt
catgacagcctttatcaagtggtatatattagtgatattaatccaaggtccgtcgcagcc
attgagggtaatctccagctattagatgtcatccattatgtgaacggagtcagcacacaa
ggaatgaccttggaggaagttaacagagcattagacatgtcacttccttcattggtattg
aaagcaacaagaaatgatcttccagtggtccccagctcaaagaggtctgctgtttcagct
ccaaagtcaaccaaaggcaatggttcctacagtgtggggtcttgcagccagcctgccctc
actcctaatgattcattctccacggttgctggggaagaaataaatgaaatatcgtacccc
aaaggaaaatgttctacttatcagataaagggatcaccaaacttgactctgcccaaagaa
tcttatatacaagaagatgacatttatgatgattcccaagaagctgaagttatccagtct
ctgctggatgttgtggatgaggaagcccagaatcttttaaacgaaaataatgcagcagga
tactcctgtggtccaggtacattaaagatgaatgggaagttatcagaagagagaacagaa
gatacagactgcgatggttcacctttacctgagtattttactgaggccaccaaaatgaat
ggctgtgaagaatattgtgaagaaaaagtaaaaagtgaaagcttaattcagaagccacaa
gaaaagaagactgatgatgatgaaataacatggggaaatgatgagttgccaatagagaga
acaaaccatgaagattctgataaagatcattcctttctgacaaacgatgagctcgctgta
ctccctgtcgtcaaagtgcttccctctggtaaatacacgggtgccaacttaaaatcagtc
attcgagtcctgcggggtttgctagatcaaggaattccttctaaggagctggagaatctt
caagaattaaaacctttggatcagtgtctaattgggcaaactaaggaaaacagaaggaag
aacagatataaaaatatacttccctatgatgctacaagagtgcctcttggagatgaaggt
ggctatatcaatgccagcttcattaagataccagttgggaaagaagagttcgtttacatt
gcctgccaaggaccactgcctacaactgttggagacttctggcagatgatttgggagcaa
aaatccacagtgatagccatgatgactcaagaagtagaaggagaaaaaatcaaatgccag
cgctattggcccaacatcctaggcaaaacaacaatggtcagcaacagacttcgactggct
cttgtgagaatgcagcagctgaagggctttgtggtgagggcaatgacccttgaagatatt
cagaccagagaggtgcgccatatttctcatctgaatttcactgcctggccagaccatgat
acaccttctcaaccagatgatctgcttacttttatctcctacatgagacacatccacaga
tcaggcccaatcattacgcactgcagtgctggcattggacgttcagggaccctgatttgc
atagatgtggttctgggattaatcagtcaggatcttgattttgacatctctgatttggtg
cgctgcatgagactacaaagacacggaatggttcagacagaggatcaatatattttctgc
tatcaagtcatcctttatgtcctgacacgtcttcaagcagaagaagagcaaaaacagcag
cctcagcttctgaagtga

DBGET integrated database retrieval system