KEGG   Homo sapiens (human): 57834Help
Entry
57834             CDS       T01001                                 

Gene name
CYP4F11, CYPIVF11
Definition
(RefSeq) cytochrome P450 family 4 subfamily F member 11
  KO
K17729  cytochrome P450 family 4 subfamily F polypeptide 11 [EC:1.14.14.1 1.14.14.78]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    57834 (CYP4F11)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     57834 (CYP4F11)
    1.14.14.78  phylloquinone omega-hydroxylase
     57834 (CYP4F11)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP4 family
   57834 (CYP4F11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 PAS_3
Motif
Other DBs
NCBI-GeneID: 57834
NCBI-ProteinID: NP_001122404
OMIM: 611517
HGNC: 13265
Ensembl: ENSG00000171903
Vega: OTTHUMG00000182294
Pharos: Q9HBI6(Tbio)
UniProt: Q9HBI6
Position
19p13.12
AA seq 524 aa AA seqDB search
MPQLSLSWLGLGPVAASPWLLLLLVGGSWLLARVLAWTYTFYDNCRRLQCFPQPPKQNWF
WGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPK
DMIFYGFLKPWLGDGLLLSGGDKWSRHRRMLTPAFHFNILKPYMKIFNKSVNIMHDKWQR
LASEGSARLDMFEHISLMTLDSLQKCVFSFESNCQEKPSEYIAAILELSAFVEKRNQQIL
LHTDFLYYLTPDGQRFRRACHLVHDFTDAVIQERRCTLPTQGIDDFLKNKAKSKTLDFID
VLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQEQCRQEVQE
LLKDREPIEIEWDDLAQLPFLTMCIKESLRLHPPVPVISRCCTQDFVLPDGRVIPKGIVC
LINIIGIHYNPTVWPDPEVYDPFRFDQENIKERSPLAFIPFSAGPRNCIGQAFAMAEMKV
VLALTLLHFRILPTHTEPRRKPELILRAEGGLWLRVEPLGANSQ
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagctgagcctgtcctggctgggcctcgggcccgtggcagcatccccgtggctg
cttctgctgctggttgggggctcctggctcctggcccgcgtcctggcctggacctacacc
ttctatgacaactgccgccgcctccagtgttttcctcaacccccgaaacagaactggttt
tggggacaccagggcctggtcactcccacggaagagggcatgaagacattgacccagctg
gtgaccacatatccccagggctttaagttgtggctgggtcctaccttccccctcctcatt
ttatgccaccctgacattatccggcctatcaccagtgcctcagctgctgtcgcacccaag
gatatgattttctatggcttcctgaagccctggctgggggatgggctcctgctgagtggt
ggtgacaagtggagccgccaccgtcggatgttgacgcctgccttccatttcaacatcttg
aagccttatatgaagattttcaacaagagtgtgaacatcatgcacgacaagtggcagcgc
ctggcctcagagggcagcgccagactggacatgtttgaacacatcagcctcatgaccttg
gacagtctgcagaaatgtgtcttcagctttgaaagcaattgtcaggagaagcccagtgaa
tatattgccgccatcttggagctcagtgcctttgtagaaaagagaaaccagcagattctc
ttgcacacggacttcctgtattatctcactcctgatgggcagcgcttccgcagggcctgc
cacctggtgcacgacttcacagatgccgtcatccaggagcggcgctgcaccctccccact
cagggtattgatgatttcctcaagaacaaggcaaagtccaagactttagacttcattgat
gtgcttctgctgagcaaggatgaagatgggaaggaattgtctgatgaggacataagagca
gaagctgacaccttcatgtttgagggccatgacactacagccagtggtctctcctgggtc
ctataccaccttgcaaagcacccagaataccaggaacagtgccggcaagaagtgcaagag
cttctgaaggaccgtgaacctatagagattgaatgggacgacctggcccagctgcccttc
ctgaccatgtgcattaaggagagcctgcggttgcatcccccagtcccggtcatctcccga
tgttgcacgcaggactttgtgctcccagacggccgcgtcatccccaaaggcattgtctgc
ctcatcaatattatcgggatccattacaacccaactgtgtggccagaccctgaggtctac
gaccccttccgtttcgaccaagagaacatcaaggagaggtcacctctggcttttattccc
ttctcggcagggcccagaaactgcatcgggcaggcgttcgccatggctgagatgaaggtg
gtcctggcgctcaccctgctgcacttccgcatcctgccgacccacactgaaccccgcagg
aaacccgagctgatattgcgcgcagagggtggactttggctgcgggtggagcccctgggt
gcgaactcacagtga

DBGET integrated database retrieval system