KEGG   Homo sapiens (human): 5784
Entry
5784              CDS       T01001                                 
Symbol
PTPN14, CATLPH, PEZ, PTP36, PTPD2
Name
(RefSeq) protein tyrosine phosphatase non-receptor type 14
  KO
K18025  tyrosine-protein phosphatase non-receptor type 14/21 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Disease
H01017  Choanal atresia and lymphedema
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5784 (PTPN14)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5784 (PTPN14)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    5784 (PTPN14)
SSDB
Motif
Pfam: Y_phosphatase FERM_N FERM_M FERM_C DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 5784
NCBI-ProteinID: NP_005392
OMIM: 603155
HGNC: 9647
Ensembl: ENSG00000152104
Vega: OTTHUMG00000037039
Pharos: Q15678(Tbio)
UniProt: Q15678 A8K6H6
Structure
Position
1:complement(214348700..214551602)
AA seq 1187 aa
MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETH
YFGLWFLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSWLQQEATRYQYYL
QVKKDVLEGRLRCTLDQVIRLAGLAVQADFGDYNQFDSQDFLREYVLFPMDLALEEAVLE
ELTQKVAQEHKAHSGILPAEAELMYINEVERLDGFGQEIFPVKDNHGNCVHLGIFFMGIF
VRNRIGRQAVIYRWNDMGNITHNKSTILVELINKEETALFHTDDIENAKYISRLFATRHK
FYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPVHVQCGEHYSETHTSQDSIFH
GNEEALYCNSHNSLDLNYLNGTVTNGSVCSVHSVNSLNCSQSFIQASPVSSNLSIPGSDI
MRADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGILHTDSQSQSLRNLNIINTHAYNQP
EDLVYSQPEMRERHPYTVPYGPQGVYSNKLVSPSDQRNPKNNVVPSKPGASAISHTVSTP
ELANMQLQGSHNYSTAHMLKNYLFRPPPPYPRPRPATSTPDLASHRHKYVSGSSPDLVTR
KVQLSVKTFQEDSSPVVHQSLQEVSEPLTATKHHGTVNKRHSLEVMNSMVRGMEAMTLKS
LHLPMARRNTLREQGPPEEGSGSHEVPQLPQYHHKKTFSDATMLIHSSESEEEEEEAPES
VPQIPMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQASLPPAMARARV
LRHGPAKAISMSRTDPPAVNGASLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLEDSI
IEREMMIRNLEKQKMAGLEAQKRPLMLAALNGLSVARVSGREENRVDATRVPMDERFRTL
KKKLEEGMVFTEYEQIPKKKANGIFSTAALPENAERSRIREVVPYEENRVELIPTKENNT
GYINASHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGVNVIAMVTAEEEGGRTKSH
RYWPKLGSKHSSATYGKFKVTTKFRTDSVCYATTGLKVKHLLSGQERTVWHLQYTDWPDH
GCPEDVQGFLSYLEEIQSVRRHTNSMLEGTKNRHPPIVVHCSAGVGRTGVLILSELMIYC
LEHNEKVEVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI
NT seq 3564 nt   +upstreamnt  +downstreamnt
atgccttttggtctgaagctccgccggacacggcgctacaacgtcctgagcaagaactgc
tttgtcacacggattcgcctgctggacagcaatgttatcgagtgcacgctgtcggtggaa
agcacagggcaagaatgcctggaggctgtggcccagaggctggagctgcgagagacgcac
tactttggcctttggtttctcagcaagagccagcaagcacgatgggtggagctggagaaa
cctctgaagaaacatctggacaaattcgctaatgagcctttgcttttctttggagtcatg
ttctatgtgccaaatgtgtcatggcttcagcaagaggccacaagatatcagtattacctg
caagtcaaaaaagatgtgcttgaagggcgattacgatgtacattggaccaggtgattcgg
ctagccggcctagctgtgcaagctgattttggagactataatcagtttgattctcaagat
ttcctcagagagtatgtgctatttcctatggatttggccctggaagaggctgttctggag
gagctgacccagaaggtagcccaagaacacaaagcccacagtggaatcctgccagcagaa
gctgaactgatgtacatcaatgaagttgaacgtttggatggatttggacaggaaatcttc
cctgtaaaggacaatcatggaaactgtgtacaccttggcattttctttatggggattttc
gtgaggaacagaattggaagacaagcggtaatatacaggtggaatgacatggggaatatc
actcataacaagtcgaccattctagtggagctcatcaacaaagaagagactgccctcttt
cacacggatgatatcgaaaatgccaagtatatttctcggttgtttgccacacgacacaag
ttttacaaacaaaacaaaatctgcactgaacagtcaaattctccaccccccatcagacgc
cagcccacctggagccgatcctctctgcccaggcagcagccgtacatcctgcctcccgtt
cacgtccagtgtggtgagcactactcggaaacgcacacctcgcaagacagcatttttcat
gggaatgaagaagccttgtattgcaactctcacaacagcctggacttaaattatttaaat
ggcactgtcaccaatggcagcgtgtgtagcgttcacagcgtcaactccctcaactgctcg
caaagtttcatccaggcctcccctgtatcctccaacctcagtatccctgggagtgacatc
atgcgggccgactacatcccgagccaccggcacagcgcgatcatcgtgccctcgtacagg
ccaacccccgattatgagacagtcatgcgccagatgaagagggggatcctgcatacagac
agccagagccagtctctgagaaacctcaacattatcaacacccatgcctacaaccagcca
gaggatctggtgtacagccaaccggagatgcgggagaggcacccctacactgtcccttat
gggccacagggggtctacagcaacaaacttgtcagtccatctgaccagaggaacccaaag
aataatgtggtaccaagcaagccgggggcaagcgccatctcgcacacggtgagcacccca
gagctggccaacatgcagctgcagggcagccataactacagcacggcccacatgcttaag
aactatctcttcaggccaccgcccccctacccacggccacgacctgccaccagcacccca
gacctggccagccaccgccacaagtacgtcagcggcagcagcccggacctggtgacccgg
aaggtgcagctctcggtgaagaccttccaagaggacagctctccggtggttcatcagtct
ctccaggaggtgagcgagcccctcacggccaccaagcaccacggcactgtgaacaagcgc
cacagcctggaggtgatgaacagcatggtgcggggcatggaggccatgacgctcaagtcg
ctccacctccccatggctcgccgcaacacgctccgggagcagggaccgcccgaggagggg
tcaggcagccacgaggtcccccagctccctcagtatcaccacaagaagaccttctctgat
gccactatgctaatccacagcagcgagagtgaggaggaggaggaggaggctccagaatcg
gtgccccagatccccatgctccgggagaagatggagtacagtgcccagctgcaggcggcc
ctggcccgcatccccaacaagcccccgcctgagtaccccggtccaaggaagagtgtgagc
aatggggctctgaggcaggaccaagccagccttcctcccgccatggccagagccagggtg
ctgaggcatgggccagccaaggccatcagcatgtctcggactgacccgccggctgtcaac
ggggcctctctcggcccatccatctcggaacccgacctgactagtgtgaaggagcgggtc
aaaaaagagcctgtgaaggagagacctgtgtctgaaatgttttccctggaagacagcatt
atagagagagagatgatgatcaggaatctagagaagcagaagatggcaggcctggaggca
cagaagaggccgctgatgttggcagcattgaatgggctctcggtggctcgagtctcaggg
cgggaagagaatcgagttgatgccacccgggttcccatggacgagaggttcagaaccctg
aagaagaaactagaagagggaatggtgttcacagaatatgagcaaattccaaagaaaaag
gcgaatggcattttcagcacagcagctctgccagaaaacgccgagcgcagccgaatccgt
gaagttgtcccctatgaggagaatcgagtagagctgataccaaccaaagaaaataacaca
ggatacattaatgcctcccacatcaaggtggtggttggcggggcagaatggcactacata
gccacccaggggcccctgccacacacgtgccacgacttctggcagatggtgtgggagcag
ggagtgaatgtgattgccatggtcactgcagaggaggagggtggacgaaccaaaagccac
cgatactggcccaaactaggttcaaagcacagctcagccacctatggcaagttcaaggtc
accacgaagtttcgaacggattctgtttgctatgcaaccacgggcttgaaggtcaagcac
cttttgtctgggcaagaaaggacggtgtggcatttacaatatactgactggccagatcac
ggctgtccagaagatgtccaaggatttttatcctacttggaggagatccagtcggtccgt
cgccataccaacagcatgctggaaggcaccaagaaccggcacccgcccatcgtggtccac
tgtagtgctggggtgggaaggaccggcgtgctcattctttctgagctgatgatctactgc
ttggaacataacgaaaaggtggaagtgcccatgatgctgaggctcctcagggagcagagg
atgttcatgatccagactatcgctcagtacaagtttgtctaccaagtcctcatccagttc
ctccaaaactccagactcatttaa

DBGET integrated database retrieval system