KEGG   Homo sapiens (human): 5786Help
Entry
5786              CDS       T01001                                 

Gene name
PTPRA, HEPTP, HLPR, HPTPA, HPTPalpha, LRP, PTPA, PTPRL2, R-PTP-alpha, RPTPA
Definition
(RefSeq) protein tyrosine phosphatase receptor type A
  KO
K18032  receptor-type tyrosine-protein phosphatase A [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5786 (PTPRA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5786 (PTPRA)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    5786 (PTPRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase DSPc Y_phosphatase3 PTPlike_phytase DUF1180
Motif
Other DBs
NCBI-GeneID: 5786
NCBI-ProteinID: NP_002827
OMIM: 176884
HGNC: 9664
Ensembl: ENSG00000132670
Vega: OTTHUMG00000031718
Pharos: P18433(Tchem)
UniProt: P18433
Position
20p13
AA seq 802 aa AA seqDB search
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLS
VAPTFSPNITLGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEP
WEGNSSTAATTPETFPPSGNSDSKDRRDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKY
KQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKL
FREEFNALPACPIQATCEAASKEENKEKNRYVNILPYDHSRVHLTPVEGVPDSDYINASF
INGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCW
TYGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGM
LKFLKKVKACNPQYAGAIVVHCSAGVGRTGTFVVIDAMLDMMHTERKVDVYGFVSRIRAQ
RCQMVQTDMQYVFIYQALLEHYLYGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKL
TSIKIQNDKMRTGNLPANMKKNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFIDGYRQK
DSYIASQGPLLHTIEDFWRMIWEWKSCSIVMLTELEERGQEKCAQYWPSDGLVSYGDITV
ELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQ
QQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQ
YEFCYKVVQEYIDAFSDYANFK
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggattcctggttcattcttgttctgctcggcagtggtctgatatgtgtcagtgccaac
aatgctaccacagttgcaccttctgtaggaattacaagattaattaactcatcaacggca
gaaccagttaaagaagaggccaaaacttcaaatccaacttcttcactaacttctctttct
gtggcaccaacattcagcccaaatataactctgggacccacctatttaaccactgtcaat
tcttcagactctgacaatgggaccacaagaacagcaagcaccaattctataggcattaca
atttcaccaaatggaacgtggcttccagataaccagttcacggatgccagaacagaaccc
tgggaggggaattccagcaccgcagcaaccactccagaaactttccctccttcaggtaat
tctgactcgaaggacagaagagatgagacaccaattattgcggtgatggtggccctgtcc
tctctgctagtgatcgtgtttattatcatagttttgtacatgttaaggtttaagaaatac
aagcaagctgggagccattccaattctttccgcttatccaacggccgcactgaggatgtg
gagccccagagtgtgccacttctggccagatccccaagcaccaacaggaaatacccaccc
ctgcccgtggacaagctggaagaggaaattaaccggagaatggcagacgacaataagctc
ttcagggaggaattcaacgctctccctgcatgtcctatccaggccacctgtgaggctgct
tccaaggaggaaaacaaggaaaaaaatcgatatgtaaacatcttgccttatgaccactct
agagtccacctgacaccggttgaaggggttccagattctgattacatcaatgcttcattc
atcaacggctaccaagaaaagaacaaattcattgctgcacaaggaccaaaagaagaaacg
gtgaatgatttctggcggatgatctgggaacaaaacacagccaccatcgtcatggttacc
aacctgaaggagagaaaggagtgcaagtgcgcccagtactggccagaccaaggctgctgg
acctatgggaatattcgggtgtctgtagaggatgtgactgtcctggtggactacacagta
cggaagttctgcatccagcaggtgggcgacatgaccaacagaaagccacagcgcctcatc
actcagttccactttaccagctggccagactttggggtgccttttaccccgatcggcatg
ctcaagttcctcaagaaggtgaaggcctgtaaccctcagtatgcaggggccatcgtggtc
cactgcagtgcaggtgtagggcgtacaggtacctttgtcgtcattgatgccatgctggac
atgatgcatacagaacggaaggtggacgtgtatggctttgtgagccggatccgggcacag
cgctgccagatggtgcaaaccgatatgcagtatgtcttcatataccaagcccttctggag
cattatctctatggagatacagaactggaagtgacctctctagaaacccacctgcagaaa
atttacaacaaaatcccagggaccagcaacaatggattagaggaggagtttaagaagtta
acatcaatcaaaatccagaatgacaagatgcggactggaaaccttccagccaacatgaag
aagaaccgtgttttacagatcattccatatgaattcaacagagtgatcattccagttaag
cggggcgaagagaatacagactatgtgaacgcatcctttattgatggctaccggcagaag
gactcctatatcgccagccagggccctcttctccacacaattgaggacttctggcgaatg
atctgggagtggaaatcctgctctatcgtgatgctaacagaactggaggagagaggccag
gagaagtgtgcccagtactggccatctgatggactggtgtcctatggagatattacagtg
gaactgaagaaggaggaggaatgtgagagctacaccgtccgagacctcctggtcaccaac
accagggagaataagagccggcagatccggcagttccacttccatggctggcctgaagtg
ggcatccccagtgacggaaagggcatgatcagcatcatcgccgccgtgcagaagcagcag
cagcagtcagggaaccaccccatcaccgtgcactgcagcgccggggcaggaaggacgggg
accttctgtgccctgagcaccgtcctggagcgtgtgaaagcagaggggattttggatgtc
ttccagactgtcaagagcctgcggctacagaggccacacatggtccagacactggaacag
tatgagttctgctacaaggtggtgcaggagtatattgatgcattctcagattatgccaac
ttcaagtaa

DBGET integrated database retrieval system