KEGG   Homo sapiens (human): 57863
Entry
57863             CDS       T01001                                 

Symbol
CADM3, BIgR, CMT2FF, IGSF4B, NECL1, Necl-1, TSLL1, synCAM3
Name
(RefSeq) cell adhesion molecule 3
  KO
K06780  cell adhesion molecule 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    57863 (CADM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    57863 (CADM3)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  Necl family
   57863 (CADM3)
SSDB
Motif
Pfam: Ig_3 Ig_2 ig I-set C2-set_2 V-set C1-set Ig_5 Izumo-Ig C2-set DUF4131 Syndecan
Other DBs
NCBI-GeneID: 57863
NCBI-ProteinID: NP_001120645
OMIM: 609743
HGNC: 17601
Ensembl: ENSG00000162706
Vega: OTTHUMG00000037177
Pharos: Q8N126(Tbio)
UniProt: Q8N126
Structure
PDB: 
1Z9M

Position
1q23.2
AA seq 398 aa
MGAPAASLLLLLLLFACCWAPGGANLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSL
QWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTA
KSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQ
EDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPD
PPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCT
ATSNMGSYKAYYTLNVNDPSPVPSSSSTYHAIIGGIVAFIVFLLLIMLIFLGHYLIRHKG
TYLTHEAKGSDDAPDADTAIINAEGGQSGGDDKKEYFI
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgggggccccagccgcctcgctcctgctcctgctcctgctgttcgcctgctgctgggcg
cccggcggggccaacctctcccaggacgacagccagccctggacatctgatgaaacagtg
gtggctggtggcaccgtggtgctcaagtgccaagtgaaagatcacgaggactcatccctg
caatggtctaaccctgctcagcagactctctactttggggagaagagagcccttcgagat
aatcgaattcagctggttacctctacgccccacgagctcagcatcagcatcagcaatgtg
gccctggcagacgagggcgagtacacctgctcaatcttcactatgcctgtgcgaactgcc
aagtccctcgtcactgtgctaggaattccacagaagcccatcatcactggttataaatct
tcattacgggaaaaagacacagccaccctaaactgtcagtcttctgggagcaagcctgca
gcccggctcacctggagaaagggtgaccaagaactccacggagaaccaacccgcatacag
gaagatcccaatggtaaaaccttcactgtcagcagctcggtgacattccaggttacccgg
gaggatgatggggcgagcatcgtgtgctctgtgaaccatgaatctctaaagggagctgac
agatccacctctcaacgcattgaagttttatacacaccaactgcgatgattaggccagac
cctccccatcctcgtgagggccagaagctgttgctacactgtgagggtcgcggcaatcca
gtcccccagcagtacctatgggagaaggagggcagtgtgccacccctgaagatgacccag
gagagtgccctgatcttccctttcctcaacaagagtgacagtggcacctacggctgcaca
gccaccagcaacatgggcagctacaaggcctactacaccctcaatgttaatgaccccagt
ccggtgccctcctcctccagcacctaccacgccatcatcggtgggatcgtggctttcatt
gtcttcctgctgctcatcatgctcatcttccttggccactacttgatccggcacaaagga
acctacctgacacatgaggcaaaaggctccgacgatgctccagacgcggacacggccatc
atcaatgcagaaggcgggcagtcaggaggggacgacaagaaggaatatttcatctag

DBGET integrated database retrieval system