KEGG   Homo sapiens (human): 5790
Entry
5790              CDS       T01001                                 
Symbol
PTPRCAP, CD45-AP, LPAP
Name
(RefSeq) protein tyrosine phosphatase receptor type C associated protein
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: PTPRCAP Saf_2TM GAPT
Other DBs
NCBI-GeneID: 5790
NCBI-ProteinID: NP_005599
OMIM: 601577
HGNC: 9667
Ensembl: ENSG00000213402
Vega: OTTHUMG00000150325
Pharos: Q14761(Tbio)
UniProt: Q14761
Position
11:complement(67435510..67437682)
AA seq 206 aa
MALPCTLGLGMLLALPGALGSGGSAEDSVGSSSVTVVLLLLLLLLLATGLALAWRRLSRD
SGGYYHPARLGAALWGRTRRLLWASPPGRWLQARAELGSTDNDLERQEDEQDTDYDHVAD
GGLQADPGEGEQQCGEASSPEQVPVRAEEARDSDTEGDLVLGSPGPASAGGSAEALLSDL
HAFAGSAAWDDSARAAGGQGLHVTAL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctctgccctgcaccttagggctcgggatgctgctggccctgccaggggccttgggc
tcgggtggcagcgcggaggacagcgtgggctccagctctgtcaccgttgtcctgctgctg
ctgctgctcctactgctggccactggcctagcactggcctggcgccgcctcagccgtgac
tcagggggctactaccacccggcccgcctaggtgccgcgctgtggggccgcacgcggcgc
ctgctctgggccagccccccaggtcgctggctgcaggcccgagctgagctggggtccaca
gacaatgaccttgagcgacaggaggatgagcaggacacagactatgaccacgtcgcggat
ggtggcctgcaggctgaccctggggaaggcgagcagcaatgtggagaggcgtccagccca
gagcaggtccccgtgcgggctgaggaagccagagacagtgacacggagggcgacctggtc
ctcggctccccaggaccagcgagcgcagggggcagtgctgaggccctgctgagtgacctg
cacgcctttgctggcagcgcagcctgggatgacagcgccagggcagctgggggccagggc
ctccatgtcaccgcactgtag

DBGET integrated database retrieval system