KEGG   Homo sapiens (human): 5792Help
Entry
5792              CDS       T01001                                 

Gene name
PTPRF, BNAH2, LAR
Definition
(RefSeq) protein tyrosine phosphatase receptor type F
  KO
K05695  receptor-type tyrosine-protein phosphatase F [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04520  Adherens junction
hsa04910  Insulin signaling pathway
hsa04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    5792 (PTPRF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    5792 (PTPRF)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5792 (PTPRF)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    5792 (PTPRF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5792 (PTPRF)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5792 (PTPRF)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    5792 (PTPRF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase fn3 I-set Ig_3 Pur_ac_phosph_N Ig_2 ig Interfer-bind fn3_2 DSPc V-set C2-set_2 Y_phosphatase3 PTPlike_phytase Ig_5 Insulin_TMD ICAM_N DUF3377
Motif
Other DBs
NCBI-GeneID: 5792
NCBI-ProteinID: NP_002831
OMIM: 179590
HGNC: 9670
Ensembl: ENSG00000142949
Vega: OTTHUMG00000007501
Pharos: P10586(Tchem)
UniProt: P10586 G1UI20
Structure
PDB: 

Position
1p34.2
AA seq 1907 aa AA seqDB search
MAPEPAPGRTMVPLVPALVMLGLVAGAHGDSKPVFIKVPEDQTGLSGGVASFVCQATGEP
KPRITWMKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSA
KLSVLEEEQLPPGFPSIDMGPQLKVVEKARTATMLCAAGGNPDPEISWFKDFLPVDPATS
NGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSS
QEVMPGGSVNLTCVAVGAPMPYVKWMMGAEELTKEDEMPVGRNVLELSNVVRSANYTCVA
ISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSGNSEPVTYYGIQYRAAGTE
GPFQEVDGVATTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRV
QARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPPNAWHKHNTDAGLLTTVGSLLP
GITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQAEVESDTRIQLSWLLPPQERI
IMYELVYWAAEDEDQQHKVTFDPTSSYTLEDLKPDTLYRFQLAARSDMGVGVFTPTIEAR
TAQSTPSAPPQKVMCVSMGSTTVRVSWVPPPADSRNGVITQYSVAYEAVDGEDRGRHVVD
GISREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEDVPSGPPRKVEVEPL
NSTAVHVYWKLPVPSKQHGQIRGYQVTYVRLENGEPRGLPIIQDVMLAEAQWRPEESEDY
ETTISGLTPETTYSVTVAAYTTKGDGARSKPKIVTTTGAVPGRPTMMISTTAMNTALLQW
HPPKELPGELLGYRLQYCRADEARPNTIDFGKDDQHFTVTGLHKGTTYIFRLAAKNRAGL
GEEFEKEIRTPEDLPSGFPQNLHVTGLTTSTTELAWDPPVLAERNGRIISYTVVFRDINS
QQELQNITTDTRFTLTGLKPDTTYDIKVRAWTSKGSGPLSPSIQSRTMPVEQVFAKNFRV
AAAMKTSVLLSWEVPDSYKSAVPFKILYNGQSVEVDGHSMRKLIADLQPNTEYSFVLMNR
GSSAGGLQHLVSIRTAPDLLPHKPLPASAYIEDGRFDLSMPHVQDPSLVRWFYIVVVPID
RVGGSMLTPRWSTPEELELDELLEAIEQGGEEQRRRRRQAERLKPYVAAQLDVLPETFTL
GDKKNYRGFYNRPLSPDLSYQCFVLASLKEPMDQKRYASSPYSDEIVVQVTPAQQQEEPE
MLWVTGPVLAVILIILIVIAILLFKRKRTHSPSSKDEQSIGLKDSLLAHSSDPVEMRRLN
YQTPGMRDHPPIPITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNR
YANVIAYDHSRVILTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWE
QRTATVVMMTRLEEKSRVKCDQYWPARGTETCGLIQVTLLDTVELATYTVRTFALHKSGS
SEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIV
IDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARNL
YAHIQKLGQVPPGESVTAMELEFKLLASSKAHTSRFISANLPCNKFKNRLVNIMPYELTR
VCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTK
LREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQF
TDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMR
YEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHYAT
NT seq 5724 nt NT seq  +upstreamnt  +downstreamnt
atggcccctgagccagccccagggaggacgatggtgccccttgtgcctgcactggtgatg
cttggtttggtggcaggcgcccatggtgacagcaaacctgtcttcattaaagtccctgag
gaccagactgggctgtcaggaggggtagcctccttcgtgtgccaagctacaggagaaccc
aagccgcgcatcacatggatgaagaaggggaagaaagtcagctcccagcgcttcgaggtc
attgagtttgatgatggggcagggtcagtgcttcggatccagccattgcgggtgcagcga
gatgaagccatctatgagtgtacagctactaacagcctgggtgagatcaacactagtgcc
aagctctcagtgctcgaagaggaacagctgccccctgggttcccttccatcgacatgggg
cctcagctgaaggtggtggagaaggcacgcacagccaccatgctatgtgccgcaggcgga
aatccagaccctgagatttcttggttcaaggacttccttcctgtagaccctgccacgagc
aacggccgcatcaagcagctgcgttcaggtgccttgcagatagagagcagtgaggaatcc
gaccaaggcaagtacgagtgtgtggcgaccaactcggcaggcacacgttactcagcccct
gcgaacctgtatgtgcgagtgcgccgcgtggctcctcgtttctccatccctcccagcagc
caggaggtgatgccaggcggcagcgtgaacctgacatgcgtggcagtgggtgcacccatg
ccctacgtgaagtggatgatgggggccgaggagctcaccaaggaggatgagatgccagtt
ggccgcaacgtcctggagctcagcaatgtcgtacgctctgccaactacacctgtgtggcc
atctcctcgctgggcatgatcgaggccacagcccaggtcacagtgaaagctcttccaaag
cctccgattgatcttgtggtgacagagacaactgccaccagtgtcaccctcacctgggac
tctgggaactcggagcctgtaacctactatggcatccagtaccgcgcagcgggcacggag
ggcccctttcaggaggtggatggtgtggccaccacccgctacagcattggcggcctcagc
cctttctcggaatatgccttccgcgtgctggcggtgaacagcatcgggcgagggccgccc
agcgaggcagtgcgggcacgcacgggagaacaggcgccctccagcccaccgcgccgcgtg
caggcacgcatgctgagcgccagcaccatgctggtgcagtgggagcctcccgaggagccc
aacggcctggtgcggggataccgcgtctactatactccggactcccgccgccccccgaac
gcctggcacaagcacaacaccgacgcggggctcctcacgaccgtgggcagcctgctgcct
ggcatcacctacagcctgcgcgtgcttgccttcaccgccgtgggcgatggccctcccagc
cccaccatccaggtcaagacgcagcagggagtgcctgcccagcccgcggacttccaggcc
gaggtggagtcggacaccaggatccagctctcgtggctgctgccccctcaggagcggatc
atcatgtatgaactggtgtactgggcggcagaggacgaagaccaacagcacaaggtgacc
ttcgacccaacctcctcctacacactagaggacctgaagcctgacacactctaccgcttc
cagctggctgcacgctcggatatgggggtgggcgtcttcacccccaccattgaggcccgc
acagcccagtccaccccctccgcccctccccagaaggtgatgtgtgtgagcatgggctcc
accacggtccgggtaagttgggtcccgccgcctgccgacagccgcaacggcgttatcacc
cagtactccgtggcctacgaggcggtggacggcgaggaccgcgggcggcatgtggtggat
ggcatcagccgtgagcactccagctgggacctggtgggcctggagaagtggacggagtac
cgggtgtgggtgcgggcacacacagacgtgggccccggccccgagagcagcccggtgctg
gtgcgcaccgatgaggacgtgcccagcgggcctccgcggaaggtggaggtggagccactg
aactccactgctgtgcatgtctactggaagctgcctgtccccagcaagcagcatggccag
atccgcggctaccaggtcacctacgtgcggctggagaatggcgagccccgtggactcccc
atcatccaagacgtcatgctagccgaggcccagtggcggccagaggagtccgaggactat
gaaaccactatcagcggcctgaccccggagaccacctactccgttactgttgctgcctat
accaccaagggggatggtgcccgcagcaagcccaaaattgtcactacaacaggtgcagtc
ccaggccggcccaccatgatgatcagcaccacggccatgaacactgcgctgctccagtgg
cacccacccaaggaactgcctggcgagctgctgggctaccggctgcagtactgccgggcc
gacgaggcgcggcccaacaccatagatttcggcaaggatgaccagcacttcacagtcacc
ggcctgcacaaggggaccacctacatcttccggcttgctgccaagaaccgggctggcttg
ggtgaggagttcgagaaggagatcaggacccccgaggacctgcccagcggcttcccccaa
aacctgcatgtgacaggactgaccacgtctaccacagaactggcctgggacccgccagtg
ctggcggagaggaacgggcgcatcatcagctacaccgtggtgttccgagacatcaacagc
caacaggagctgcagaacatcacgacagacacccgctttacccttactggcctcaagcca
gacaccacttacgacatcaaggtccgcgcatggaccagcaaaggctctggcccactcagc
cccagcatccagtcccggaccatgccggtggagcaagtgtttgccaagaacttccgggtg
gcggctgcaatgaagacgtctgtgctgctcagctgggaggttcccgactcctataagtca
gctgtgccctttaagattctgtacaatgggcagagtgtggaggtggacgggcactcgatg
cggaagctgatcgcagacctgcagcccaacacagagtactcgtttgtgctgatgaaccgt
ggcagcagcgcagggggcctgcagcacctggtgtccatccgcacagcccccgacctcctg
cctcacaagccgctgcctgcctctgcctacatagaggacggccgcttcgatctctccatg
ccccatgtgcaagacccctcgcttgtcaggtggttctacattgttgtggtgcccattgac
cgtgtgggcgggagcatgctgacgccaaggtggagcacacccgaggaactggagctggac
gagcttctagaagccatcgagcaaggcggagaggagcagcggcggcggcggcggcaggca
gaacgtctgaagccatatgtggctgctcaactggatgtgctcccggagacctttaccttg
ggggacaagaagaactaccggggcttctacaaccggcccctgtctccggacttgagctac
cagtgctttgtgcttgcctccttgaaggaacccatggaccagaagcgctatgcctccagc
ccctactcggatgagatcgtggtccaggtgacaccagcccagcagcaggaggagccggag
atgctgtgggtgacgggtcccgtgctggcagtcatcctcatcatcctcattgtcatcgcc
atcctcttgttcaaaaggaaaaggacccactctccgtcctctaaggatgagcagtcgatc
ggactgaaggactccttgctggcccactcctctgaccctgtggagatgcggaggctcaac
taccagaccccaggtatgcgagaccacccacccatccccatcaccgacctggcggacaac
atcgagcgcctcaaagccaacgatggcctcaagttctcccaggagtatgagtccatcgac
cctggacagcagttcacgtgggagaattcaaacctggaggtgaacaagcccaagaaccgc
tatgcgaatgtcatcgcctacgaccactctcgagtcatccttacctctatcgatggcgtc
cccgggagtgactacatcaatgccaactacatcgatggctaccgcaagcagaatgcctac
atcgccacgcagggccccctgcccgagaccatgggtgatttctggaggatggtgtgggaa
cagcgcacggccactgtggtcatgatgacacggctggaggagaagtcccgggtaaaatgt
gatcagtactggccagcccgtggcaccgagacctgtggccttattcaggtgaccctgttg
gacacagtggagctggccacatacactgtgcgcaccttcgcactccacaagagtggctcc
agtgagaagcgcgagctgcgtcagtttcagttcatggcctggccagaccatggagttcct
gagtacccaactcccatcctggccttcctacgacgggtcaaggcctgcaaccccctagac
gcagggcccatggtggtgcactgcagcgcgggcgtgggccgcaccggctgcttcatcgtg
attgatgccatgttggagcggatgaagcacgagaagacggtggacatctatggccacgtg
acctgcatgcgatcacagaggaactacatggtgcagacggaggaccagtacgtgttcatc
catgaggcgctgctggaggctgccacgtgcggccacacagaggtgcctgcccgcaacctg
tatgcccacatccagaagctgggccaagtgcctccaggggagagtgtgaccgccatggag
ctcgagttcaagttgctggccagctccaaggcccacacgtcccgcttcatcagcgccaac
ctgccctgcaacaagttcaagaaccggctggtgaacatcatgccctacgaattgacccgt
gtgtgtctgcagcccatccgtggtgtggagggctctgactacatcaatgccagcttcctg
gatggttatagacagcagaaggcctacatagctacacaggggcctctggcagagagcacc
gaggacttctggcgcatgctatgggagcacaattccaccatcatcgtcatgctgaccaag
cttcgggagatgggcagggagaaatgccaccagtactggccagcagagcgctctgctcgc
taccagtactttgttgttgacccgatggctgagtacaacatgccccagtatatcctgcgt
gagttcaaggtcacggatgcccgggatgggcagtcaaggacaatccggcagttccagttc
acagactggccagagcagggcgtgcccaagacaggcgagggattcattgacttcatcggg
caggtgcataagaccaaggagcagtttggacaggatgggcctatcacggtgcactgcagt
gctggcgtgggccgcaccggggtgttcatcactctgagcatcgtcctggagcgcatgcgc
tacgagggcgtggtcgacatgtttcagaccgtgaagaccctgcgtacacagcgtcctgcc
atggtgcagacagaggaccagtatcagctgtgctaccgtgcggccctggagtacctcggc
agctttgaccactatgcaacgtaa

DBGET integrated database retrieval system