KEGG   Homo sapiens (human): 5798Help
Entry
5798              CDS       T01001                                 

Gene name
PTPRN, IA-2, IA-2/PTP, IA2, ICA512, R-PTP-N
Definition
(RefSeq) protein tyrosine phosphatase receptor type N
  KO
K07817  receptor-type tyrosine-protein phosphatase N [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04940  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    5798 (PTPRN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5798 (PTPRN)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5798 (PTPRN)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    5798 (PTPRN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase RESP18 Receptor_IA-2 DSPc
Motif
Other DBs
NCBI-GeneID: 5798
NCBI-ProteinID: NP_002837
OMIM: 601773
HGNC: 9676
Ensembl: ENSG00000054356
Vega: OTTHUMG00000133129
Pharos: Q16849(Tbio)
UniProt: Q16849 Q96IA0
Structure
PDB: 

Position
2q35
AA seq 979 aa AA seqDB search
MRRPRRPGGLGGSGGLRLLLCLLLLSSRPGGCSAVSAHGCLFDRRLCSHLEVCIQDGLFG
QCQVGVGQARPLLQVTSPVLQRLQGVLRQLMSQGLSWHDDLTQYVISQEMERIPRLRPPE
PRPRDRSGLAPKRPGPAGELLLQDIPTGSAPAAQHRLPQPPVGKGGAGASSSLSPLQAEL
LPPLLEHLLLPPQPPHPSLSYEPALLQPYLFHQFGSRDGSRVSEGSPGMVSVGPLPKAEA
PALFSRTASKGIFGDHPGHSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQG
SSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTL
LTLLQLLPKGAGRNPGGVVNVGADIKKTMEGPVEGRDTAELPARTSPMPGHPTASPTSSE
VQQVPSPVSSEPPKAARPPVTPVLLEKKSPLGQSQPTVAGQPSARPAAEEYGYIVTDQKP
LSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSE
LEAQTGLQILQTGVGQREEAAAVLPQTAHSTSPMRSVLLTLVALAGVAGLLVALAVALCV
RQHARQQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQ
FSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQ
AEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAY
IATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVNLV
SEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRG
RSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFE
FALTAVAEEVNAILKALPQ
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcccgcggcggcctgggggtctcgggggatccgggggtctccggctgctcctc
tgcctcctgctgctgagcagccgcccggggggctgcagcgccgttagtgcccacggctgt
ctatttgaccgcaggctctgctctcacctggaagtctgtattcaggatggcttgtttggg
cagtgccaggtgggagtggggcaggcccggccccttttgcaagtcacctccccagttctc
caacgcttacaaggtgtgctccgacaactcatgtcccaaggattgtcctggcacgatgac
ctcacccagtatgtgatctctcaggagatggagcgcatccccaggcttcgccccccagag
ccccgtccaagggacaggtctggcttggcacccaagagacctggtcctgctggagagctg
cttttacaggacatccccactggctccgcccctgctgcccagcatcggcttccacaacca
ccagtgggcaaaggtggagctggggccagctcctctctgtcccctctgcaggctgagctg
ctcccgcctctcttggagcacctgctgctgcccccacagcctccccacccttcactgagt
tacgaacctgccttgctgcagccctacctgttccaccagtttggctcccgtgatggctcc
agggtctcagagggctccccagggatggtcagtgtcggccccctgcccaaggctgaagcc
cctgccctcttcagcagaactgcctccaagggcatatttggggaccaccctggccactcc
tacggggaccttccagggccttcacctgcccagctttttcaagactctgggctgctctat
ctggcccaggagttgccagcacccagcagggccagggtgccaaggctgccagagcaaggg
agcagcagccgggcagaggactccccagagggctatgagaaggaaggactaggggatcgt
ggagagaagcctgcttccccagctgtgcagccagatgcggctctgcagaggctggccgct
gtgctggcgggctatggggtagagctgcgtcagctgacccctgagcagctctccacactc
ctgaccctgctgcagctactgcccaagggtgcaggaagaaatccgggaggggttgtaaat
gttggagctgatatcaagaaaacaatggaggggccggtggagggcagagacacagcagag
cttccagcccgcacatcccccatgcctggacaccccactgccagccctacctccagtgaa
gtccagcaggtgccaagccctgtctcctctgagcctcccaaagctgccagaccccctgtg
acacctgtcctgctagagaagaaaagcccactgggccagagccagcccacggtggcagga
cagccctcagcccgcccagcagcagaggaatatggctacatcgtcactgatcagaagccc
ctgagcctggctgcaggagtgaagctgctggagatcctggctgagcatgtgcacatgtcc
tcaggcagcttcatcaacatcagtgtggtgggaccagccctcaccttccgcatccggcac
aatgagcagaacctgtctttggctgatgtgacccaacaagcagggctggtgaagtctgaa
ctggaagcacagacagggctccaaatcttgcagacaggagtgggacagagggaggaggca
gctgcagtccttccccaaactgcgcacagcacctcacccatgcgctcagtgctgctcact
ctggtggccctggcaggtgtggctgggctgctggtggctctggctgtggctctgtgtgtg
cggcagcatgcgcggcagcaagacaaggagcgcctggcagccctggggcctgagggggcc
catggtgacactacctttgagtaccaggacctgtgccgccagcacatggccacgaagtcc
ttgttcaaccgggcagagggtccaccggagccttcacgggtgagcagtgtgtcctcccag
ttcagcgacgcagcccaggccagccccagctcccacagcagcaccccgtcctggtgcgag
gagccggcccaagccaacatggacatctccacgggacacatgattctggcatacatggag
gatcacctgcggaaccgggaccgccttgccaaggagtggcaggccctctgtgcctaccaa
gcagagccaaacacctgtgccaccgcgcagggggagggcaacatcaaaaagaaccggcat
cctgacttcctgccctatgaccatgcccgcataaaactgaaggtggagagcagcccttct
cggagcgattacatcaacgccagccccattattgagcatgaccctcggatgccagcctac
atagccacgcagggcccgctgtcccataccatcgcagacttctggcagatggtgtgggag
agcggctgcaccgtcatcgtcatgctgaccccgctggtggaggatggtgtcaagcagtgt
gaccgctactggccagatgagggtgcctccctctaccacgtatatgaggtgaacctggtg
tcggagcacatctggtgcgaggactttctggtgcggagcttctacctgaagaacgtgcag
acccaggagacgcgcacgctcacgcagttccacttcctcagctggccggcagagggcaca
ccggcctccacgcggcccctgctggacttccgcaggaaggtgaacaagtgctaccggggc
cgctcctgccccatcatcgtgcactgcagtgatggtgcggggaggaccggcacctacatc
ctcatcgacatggtcctgaaccgcatggcaaaaggagtgaaggagattgacatcgctgcc
accctggagcatgtccgtgaccagcggcctggccttgtccgctctaaggaccagtttgaa
tttgccctgacagccgtggcggaggaagtgaatgccatcctcaaggccctgccccagtga

KEGG   Homo sapiens (human): 5799Help
Entry
5799              CDS       T01001                                 

Gene name
PTPRN2, IA-2beta, IAR, ICAAR, PTPRP, R-PTP-N2
Definition
(RefSeq) protein tyrosine phosphatase receptor type N2
  KO
K07817  receptor-type tyrosine-protein phosphatase N [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04940  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    5799 (PTPRN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5799 (PTPRN2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5799 (PTPRN2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    5799 (PTPRN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase Receptor_IA-2 RESP18 DSPc
Motif
Other DBs
NCBI-GeneID: 5799
NCBI-ProteinID: NP_002838
OMIM: 601698
HGNC: 9677
Ensembl: ENSG00000155093
Vega: OTTHUMG00000152646
Pharos: Q92932(Tbio)
UniProt: Q92932 I6L9F8
Structure
PDB: 

Position
7q36.3
AA seq 1015 aa AA seqDB search
MGPPLPLLLLLLLLLPPRVLPAAPSSVPRGRQLPGRLGCLLEEGLCGASEACVNDGVFGR
CQKVPAMDFYRYEVSPVALQRLRVALQKLSGTGFTWQDDYTQYVMDQELADLPKTYLRRP
EASSPARPSKHSVGSERRYSREGGAALANALRRHLPFLEALSQAPASDVLARTHTAQDRP
PAEGDDRFSESILTYVAHTSALTYPPGSRTQLREDLLPRTLGQLQPDELSPKVDSGVDRH
HLMAALSAYAAQRPPAPPGEGSLEPQYLLRAPSRMPRPLLAPAAPQKWPSPLGDSEDPSS
TGDGARIHTLLKDLQRQPAEVRGLSGLELDGMAELMAGLMQGVDHGVARGSPGRAALGES
GEQADGPKATLRGDSFPDDGVQDDDDRLYQEVHRLSATLGGLLQDHGSRLLPGALPFARP
LDMERKKSEHPESSLSSEEETAGVENVKSQTYSKDLLGQQPHSEPGAAAFGELQNQMPGP
SKEEQSLPAGAQEALSDGLQLEVQPSEEEARGYIVTDRDPLRPEEGRRLVEDVARLLQVP
SSAFADVEVLGPAVTFKVSANVQNVTTEDVEKATVDNKDKLEETSGLKILQTGVGSKSKL
KFLPPQAEQEDSTKFIALTLVSLACILGVLLASGLIYCLRHSSQHRLKEKLSGLGGDPGA
DATAAYQELCRQRMATRPPDRPEGPHTSRISSVSSQFSDGPIPSPSARSSASSWSEEPVQ
SNMDISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNSSFVAQREENVPKNRSLAVL
TYDHSRVLLKAENSHSHSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWESGCV
VIVMLTPLAENGVRQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNET
RTVTQFHFLSWYDRGVPSSSRSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDM
VLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILKALPQ
NT seq 3048 nt NT seq  +upstreamnt  +downstreamnt
atggggccgccgctcccgctgctgctgctgctactgctgctgctgccgccacgcgtcctg
cctgccgccccttcgtccgtcccccgcggccggcagctcccggggcgtctgggctgcctg
ctcgaggagggcctctgcggagcgtccgaggcctgtgtgaacgatggagtgtttggaagg
tgccagaaggttccggcaatggacttttaccgctacgaggtgtcgcccgtggccctgcag
cgcctgcgcgtggcgttgcagaagctttccggcacaggtttcacgtggcaggatgactat
actcagtatgtgatggaccaggaacttgcagacctcccgaaaacctacctgaggcgtcct
gaagcatccagcccagccaggccctcaaaacacagcgttggcagcgagaggaggtacagt
cgggagggcggtgctgccctggccaacgccctccgacgccacctgcccttcctggaggcc
ctgtcccaggccccagcctcagacgtgctcgccaggacccatacggcgcaggacagaccc
cccgctgagggtgatgaccgcttctccgagagcatcctgacctatgtggcccacacgtct
gcgctgacctaccctcccgggtcccggacccagctccgcgaggacctcctgccgcggacc
ctcggccagctccagccagatgagctcagccctaaggtggacagtggtgtggacagacac
catctgatggcggccctcagtgcctatgctgcccagaggcccccagctccccccggggag
ggcagcctggagccacagtaccttctgcgtgcaccctcaagaatgcccaggcctttgctg
gcaccagccgccccccagaagtggccttcacctctgggagattccgaagacccctccagc
acaggcgatggagcacggattcataccctcctgaaggacctgcagaggcagccggctgag
gtgaggggcctgagtggcctggagctggacggcatggctgagctgatggctggcctgatg
caaggcgtggaccatggagtagctcgaggcagccctgggagagcggccctgggagagtct
ggagaacaggcggatggccccaaggccaccctccgtggagacagctttccagatgacgga
gtgcaggacgacgatgatagactttaccaagaggtccatcgtctgagtgccacactcggg
ggcctcctgcaggaccacgggtctcgactcttacctggagccctcccctttgcaaggccc
ctcgacatggagaggaagaagtccgagcaccctgagtcttccctgtcttcagaagaggag
actgccggagtggagaacgtcaagagccagacgtattccaaagatctgctggggcagcag
ccgcattcggagcccggggccgctgcgtttggggagctccaaaaccagatgcctgggccc
tcgaaggaggagcagagccttccagcgggtgctcaggaggccctcagcgacggcctgcaa
ttggaggtccagccttccgaggaagaggcgcggggctacatcgtgacagacagagacccc
ctgcgccccgaggaaggaaggcggctggtggaggacgtcgcccgcctcctgcaggtgccc
agcagtgcgttcgctgacgtggaggttctcggaccagcagtgaccttcaaagtgagcgcc
aatgtccaaaacgtgaccactgaggatgtggagaaggccacagttgacaacaaagacaaa
ctggaggaaacctctggactgaaaattcttcaaaccggagtcgggtcgaaaagcaaactc
aagttcctgcctcctcaggcggagcaagaagactccaccaagttcatcgcgctcaccctg
gtctccctcgcctgcatcctgggcgtcctcctggcctctggcctcatctactgcctccgc
catagctctcagcacaggctgaaggagaagctctcgggactagggggcgacccaggtgca
gatgccactgccgcctaccaggagctgtgccgccagcgtatggccacgcggccaccagac
cgacctgagggcccgcacacgtcacgcatcagcagcgtctcatcccagttcagcgacggg
ccgatccccagcccctccgcacgcagcagcgcctcatcctggtccgaggagcctgtgcag
tccaacatggacatctccaccggccacatgatcctgtcctacatggaggaccacctgaag
aacaagaaccggctggagaaggagtgggaagcgctgtgcgcctaccaggcggagcccaac
agctcgttcgtggcccagagggaggagaacgtgcccaagaaccgctccctggccgtgctg
acctatgaccactcccgggtcctgctgaaggcggagaacagccacagccactcagactac
atcaacgctagccccatcatggatcacgacccgaggaaccccgcgtacatcgccacccag
ggaccgctgcccgccaccgtggctgacttttggcagatggtgtgggagagcggctgcgtg
gtgatcgtcatgctgacacccctcgcggagaacggcgtccggcagtgctaccactactgg
ccggatgaaggctccaatctctaccacatctatgaggtgaacctggtctccgagcacatc
tggtgtgaggacttcctggtgaggagcttctatctgaagaacctgcagaccaacgagacg
cgcaccgtgacgcagttccacttcctgagttggtatgaccgaggagtcccttcctcctca
aggtccctcctggacttccgcagaaaagtaaacaagtgctacaggggccgttcttgtcca
ataattgttcattgcagtgacggtgcaggccggagcggcacctacgtcctgatcgacatg
gttctcaacaagatggccaaaggtgctaaagagattgatatcgcagcgaccctggagcac
ttgagggaccagagacccggcatggtccagacgaaggagcagtttgagttcgcgctgaca
gccgtggctgaggaggtgaacgccatcctcaaggcccttccccagtga

DBGET integrated database retrieval system