KEGG   Homo sapiens (human): 5800Help
Entry
5800              CDS       T01001                                 

Gene name
PTPRO, GLEPP1, NPHS6, PTP-OC, PTP-U2, PTPROT, PTPU2, R-PTP-O
Definition
(RefSeq) protein tyrosine phosphatase receptor type O
  KO
K18035  receptor-type tyrosine-protein phosphatase O [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Disease
H01657  Nephrotic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5800 (PTPRO)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5800 (PTPRO)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    5800 (PTPRO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase fn3 DSPc Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 5800
NCBI-ProteinID: NP_109592
OMIM: 600579
HGNC: 9678
Ensembl: ENSG00000151490
Vega: OTTHUMG00000168786
Pharos: Q16827(Tbio)
UniProt: Q16827
Structure
PDB: 

Position
12p12.3; 12p13-p12
AA seq 1216 aa AA seqDB search
MGHLPTGIHGARRLLPLLWLFVLFKNATAFHVTVQDDNNIVVSLEASDVISPASVYVVKI
TGESKNYFFEFEEFNSTLPPPVIFKASYHGLYYIITLVVVNGNVVTKPSRSITVLTKPLP
VTSVSIYDYKPSPETGVLFEIHYPEKYNVFTRVNISYWEGKDFRTMLYKDFFKGKTVFNH
WLPGMCYSNITFQLVSEATFNKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNW
EEQSGNFPEESFMRSQDTIGKEKLFHFTEETPEIPSGNISSGWPDFNSSDYETTSQPYWW
DSASAAPESEDEFVSVLPMEYENNSTLSETEKSTSGSFSFFPVQMILTWLPPKPPTAFDG
FHIHIEREENFTEYLMVDEEAHEFVAELKEPGKYKLSVTTFSSSGSCETRKSQSAKSLSF
YISPSGEWIEELTEKPQHVSVHVLSSTTALMSWTSSQENYNSTIVSVVSLTCQKQKESQR
LEKQYCTQVNSSKPIIENLVPGAQYQVVIYLRKGPLIGPPSDPVTFAIVPTGIKDLMLYP
LGPTAVVLSWTRPYLGVFRKYVVEMFYFNPATMTSEWTTYYEIAATVSLTASVRIANLLP
AWYYNFRVTMVTWGDPELSCCDSSTISFITAPVAPEITSVEYFNSLLYISWTYGDDTTDL
SHSRMLHWMVVAEGKKKIKKSVTRNVMTAILSLPPGDIYNLSVTACTERGSNTSMLRLVK
LEPAPPKSLFAVNKTQTSVTLLWVEEGVADFFEVFCQQVGSSQKTKLQEPVAVSSHVVTI
SSLLPATAYNCSVTSFSHDSPSVPTFIAVSTMVTEMNPNVVVISVLAILSTLLIGLLLVT
LIILRKKHLQMARECGAGTFVNFASLERDGKLPYNWRRSIFAFLTLLPSCLWTDYLLAFY
INPWSKNGLKKRKLTNPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLP
LNRCKNRYTNILPYDFSRVRLVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETRND
FWKMVLQQKSQIIVMLTQCNEKRRVKCDHYWPFTEEPIAYGDITVEMISEEEQDDWACRH
FRINYADEMQDVMHFNYTAWPDHGVPTANAAESILQFVHMVRQQATKSKGPMIIHCSAGV
GRTGTFIALDRLLQHIRDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLMWMKKK
QQFCISDVIYENVSKS
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atggggcacctgcccacggggatacacggcgcccgccgcctcctgcctctgctctggctc
tttgtgctgttcaagaatgctacagctttccatgtaactgtccaagatgataataacatc
gttgtctcattagaagcttcagacgtcatcagtccagcatctgtgtatgttgtgaagata
actggtgaatccaaaaattatttcttcgaatttgaggaattcaacagcactttgcctcct
cctgttattttcaaggccagttatcatggcctttattatataatcactctggtagtggta
aatggaaatgtggtgaccaagccatccagatcaatcactgtgttaacaaaacctctacct
gtaaccagtgtttccatatatgactataaaccttctcctgaaacaggagtcctgtttgaa
atacattatccagaaaaatataacgttttcacaagagtgaacattagctactgggaaggt
aaagacttccggacaatgctatataaagatttctttaagggaaaaacagtatttaatcac
tggctgccaggaatgtgttatagtaatatcacctttcagctggtatctgaggcaactttt
aataaaagtacccttgttgagtacagtggtgtcagtcacgaacccaaacagcacagaact
gccccttatccacctcaaaatatttccgttcgtatcgtaaacttgaacaaaaacaactgg
gaagaacagagtggcaatttcccagaagaatccttcatgagatcacaagatacaatagga
aaagaaaaactcttccattttacagaagaaacccctgaaattccctcgggcaacatttct
tccggttggcctgattttaatagcagtgactatgaaactacgtctcagccatattggtgg
gacagtgcatctgcagctcctgaaagtgaagatgaatttgtcagcgtacttcccatggaa
tacgaaaataacagtacactcagtgagacagagaagtcaacatcaggctctttctccttt
ttccctgtgcaaatgatattgacctggttaccacccaaaccacccactgcttttgatggg
ttccatatccatattgaacgagaagagaactttactgaatatttgatggtggatgaagaa
gcacatgaatttgttgcagaactgaaggaacctgggaaatataagttatctgtgacaacc
tttagttcctcaggatcttgtgaaactcgaaaaagtcagtcagcaaaatcactcagcttt
tatatcagtccttcaggagagtggattgaagaactgaccgagaagccgcagcacgtgagt
gtccacgttttaagctcaaccactgccttgatgtcctggacatcttcccaagagaactac
aacagcaccattgtgtctgtggtgtcgctgacctgccagaaacaaaaggagagccagagg
cttgaaaagcagtactgcactcaggtgaactcaagcaaacctattattgaaaatctggtt
cctggtgcccagtaccaggttgtaatatacctaaggaaaggccctttgattggaccacct
tcagatcctgtgacatttgctattgttcccacaggaataaaggatttaatgctctatcct
ttgggtcctacggccgtggttctgagctggaccagaccttatttaggcgtgttcagaaaa
tacgtggttgaaatgttttatttcaaccctgctacaatgacatcagagtggaccacctac
tatgaaatagcagcaactgtttccttaactgcatccgtgagaatagctaatctgctgcca
gcatggtactacaacttccgggttaccatggtgacgtggggagatccagaattgagctgc
tgtgacagctctaccatcagcttcataacagccccagtggctccggaaatcacttctgtg
gaatatttcaacagtctgttatatatcagttggacatatggggatgatacaacggacttg
tcccattctagaatgcttcactggatggtggttgcagaaggaaaaaagaaaattaaaaag
agtgtaacacgcaatgtcatgactgcaattctcagcttgcctccaggcgacatctataac
ctctcagtaactgcttgtactgaaagaggaagtaatacctccatgctccgccttgtcaag
ctagaaccagctccacccaaatcactcttcgcagtgaacaaaacccagacttcagtgact
ttgctgtgggtggaagagggagtagctgatttctttgaagttttctgtcaacaagttggc
tccagtcagaaaaccaaacttcaggaaccagttgctgtttcttcccatgtcgtgaccatc
tccagccttcttcctgccactgcctacaattgtagtgtcaccagctttagccatgacagc
cccagtgtccctacgttcatagccgtctcaacaatggttacagagatgaatcccaatgtg
gtagtgatctccgtgctggccatccttagcacacttttaattggactgttgcttgttacc
ctcattattcttaggaaaaagcatctgcagatggctagggagtgtggagctggtacattt
gtcaattttgcatccttagagagggatggaaagcttccatacaactggcgtaggagtata
tttgctttcttaaccctgctaccctcatgtctttggactgattatcttttggcattttat
attaatccttggagtaaaaatggtttaaagaagaggaaactgacaaacccggttcaactg
gatgactttgatgcctatattaaggatatggccaaagactctgactataaattttctctt
cagtttgaggagttgaaattgattggactggatatcccacactttgctgcagatcttcca
ctgaatcgatgtaaaaaccgttacacaaacatcctaccatatgacttcagccgtgtgaga
ttagtctccatgaatgaagaggaaggtgcagactacatcaatgccaactatattcctgga
tacaactcaccccaggagtatattgccacccaggggccactgcctgaaaccagaaatgac
ttctggaagatggtcctgcaacaaaagtctcagattattgtcatgctcactcagtgtaat
gagaaaaggagggtgaaatgtgaccattactggccattcacggaagaacctatagcctat
ggagacatcactgtggagatgatttcagaggaagagcaggacgactgggcctgtagacac
ttccggatcaactatgctgacgagatgcaggatgtgatgcattttaactacactgcatgg
cctgatcatggtgtgcccacagcaaatgctgcagaaagtatcctgcagtttgtacacatg
gtccgacagcaagctaccaagagcaaaggtcccatgatcattcactgcagtgctggcgtg
ggacggacaggaacattcattgccctggacaggctcttgcagcacattcgggatcatgag
tttgttgacatcttagggctggtgtcagaaatgaggtcataccggatgtctatggtacag
acagaggagcagtacatttttatccatcagtgtgtgcaactgatgtggatgaagaagaag
cagcagttctgcatcagtgatgtcatatacgagaatgttagcaagtcctag

DBGET integrated database retrieval system