KEGG   Homo sapiens (human): 5801Help
Entry
5801              CDS       T01001                                 

Gene name
PTPRR, EC-PTP, PCPTP1, PTP-SL, PTPBR7, PTPRQ
Definition
(RefSeq) protein tyrosine phosphatase, receptor type R
  KO
K04458  receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    5801 (PTPRR)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5801 (PTPRR)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    5801 (PTPRR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase DSPc Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 5801
NCBI-ProteinID: NP_002840
OMIM: 602853
HGNC: 9680
Ensembl: ENSG00000153233
Vega: OTTHUMG00000169502
Pharos: Q15256(Tbio)
UniProt: Q15256
Structure
PDB: 

Position
12q15
AA seq 657 aa AA seqDB search
MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFIYKHSQDIEKSLDIAPQK
IYRHSYHSSSEAQVSKRHQIVNSAFPRPAYDPSLNLLAMDGQDLEVENLPIPAANVIVVT
LQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDAL
PSEEVLRSLNINVLHQSLSQFGITEVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFVI
IVTCLMILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLN
VVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIP
TPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNR
YKTILPNPLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVDDFWQMV
WQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNECDNYTIRNLVLKQGSH
TQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIA
TSIGCQQLKEEGVVDALSIVCQLRMDRGGMVQTSEQYEFVHHALCLYESRLSAETVQ
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgcggagagcagtctgcttccctgcgctgtgcctgctccttaatcttcacgctgcaggg
tgcttttcaggaaacaatgatcattttttggcaattaatcagaagaagagtgggaagccg
gtattcatttataagcattcacaagacattgagaagagcctggatatagccccacaaaaa
atctacagacatagctaccattcctcttccgaagctcaagtaagcaaacgccaccagatt
gtcaattcagcatttcctagacccgcatatgacccgtctctcaatctgctggccatggat
ggtcaagatcttgaagtggaaaatctcccaatcccagcagcaaatgtaattgtggtgaca
ctgcaaatggatgtaaacaagctgaacataaccttgcttcggatcttccgccaaggagtg
gctgcagctttaggactcttaccccagcaagtgcacatcaatcgcctcattggaaagaag
aacagtattgaactgtttgtgtctcccataaaccgaaaaacaggaatttctgatgctctg
ccctctgaggaagttcttcgttcacttaatatcaatgttttgcatcaaagtttatcccag
tttggaattacagaagtctctcctgagaaaaatgttttacaagggcagcatgaagcggac
aaaatctggagcaaagaaggattttatgctgttgtcatttttctcagcatctttgttatt
atagtaacgtgtttgatgattctttacagattaaaagaaagatttcagctttccttaaga
caagacaaagagaaaaaccaggagatccacctatcgcccatcacattacagccagcactg
tccgaggcaaagacagtccacagcatggtccaacctgagcaggccccaaaggtactgaat
gttgtcgtggaccctcaaggccgaggtgctcctgagatcaaagctaccaccgctacctct
gtttgcccttctcctttcaaaatgaagcccataggacttcaagagagaagagggtccaac
gtatctcttacattggacatgagtagcttggggaacattgaaccctttgtgtctatacca
acaccacgggagaaggtagcaatggagtatctgcagtcagccagccgaattctcacaagg
tctcagctgagggacgtcgtggcaagttcacatttactccaaagtgaattcatggaaata
ccaatgaactttgtggatcccaaagaaattgatattccgcgtcatggaactaaaaatcgc
tataagaccattttaccaaatcccctcagcagagtgtgtttaagaccaaaaaatgtaacc
gattcattgagcacctacattaatgctaattatattaggggctacagtggcaaggagaaa
gccttcattgccacgcagggccccatgatcaacaccgtggatgatttctggcagatggtt
tggcaggaagacagccctgtgattgttatgatcacaaaactcaaagaaaaaaatgagaaa
tgtgtgctatactggccggaaaagagagggatatatggaaaagttgaggttctggttatc
agtgtaaatgaatgtgataactacaccattcgaaaccttgtcttaaagcaaggaagccac
acccaacatgtgaagcattactggtacacctcatggcctgatcacaagactccagacagt
gcccagcccctcctacagctcatgctggatgtagaagaagacagacttgcttcccagggc
cgagggcctgtggttgtccactgcagtgcaggaataggtagaacagggtgttttattgct
acatccattggctgtcaacagctgaaagaagaaggagttgtggatgcactaagcattgtc
tgccagcttcgtatggatagaggtggaatggtgcaaaccagtgagcagtatgaatttgtg
caccatgctctgtgcctgtatgagagcagactttcagcagagactgtccagtga

DBGET integrated database retrieval system