KEGG   Homo sapiens (human): 581Help
Entry
581               CDS       T01001                                 

Gene name
BAX, BCL2L4
Definition
(RefSeq) BCL2 associated X, apoptosis regulator
  KO
K02159  apoptosis regulator BAX
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa01524  Platinum drug resistance
hsa04071  Sphingolipid signaling pathway
hsa04115  p53 signaling pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04211  Longevity regulating pathway
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04722  Neurotrophin signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05016  Huntington's disease
hsa05020  Prion diseases
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
N00098  Intrinsic apoptotic pathway
N00099  Mutation-inactivated BAX to apoptotic pathway
N00100  BCL2-overexpression to intrinsic apoptotic pathway
N00115  Mutation-inactivated TP53 to transcription
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00164  KSHV vBCL2 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00199  KSHV vBCL2 to host-cell-protein inhibition
N00273  HCV NS5A to host-cell-protein inhibition
Disease
H00020  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    581 (BAX)
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    581 (BAX)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    581 (BAX)
   04215 Apoptosis - multiple species
    581 (BAX)
   04217 Necroptosis
    581 (BAX)
   04115 p53 signaling pathway
    581 (BAX)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    581 (BAX)
  Aging
   04211 Longevity regulating pathway - mammal
    581 (BAX)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    581 (BAX)
   05202 Transcriptional misregulation in cancers
    581 (BAX)
   05203 Viral carcinogenesis
    581 (BAX)
   05210 Colorectal cancer
    581 (BAX)
   05212 Pancreatic cancer
    581 (BAX)
   05225 Hepatocellular carcinoma
    581 (BAX)
   05226 Gastric cancer
    581 (BAX)
   05214 Glioma
    581 (BAX)
   05216 Thyroid cancer
    581 (BAX)
   05220 Chronic myeloid leukemia
    581 (BAX)
   05217 Basal cell carcinoma
    581 (BAX)
   05218 Melanoma
    581 (BAX)
   05213 Endometrial cancer
    581 (BAX)
   05224 Breast cancer
    581 (BAX)
   05222 Small cell lung cancer
    581 (BAX)
   05223 Non-small cell lung cancer
    581 (BAX)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    581 (BAX)
   05016 Huntington's disease
    581 (BAX)
   05020 Prion diseases
    581 (BAX)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    581 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    581 (BAX)
  Infectious diseases
   05152 Tuberculosis
    581 (BAX)
   05166 HTLV-I infection
    581 (BAX)
   05161 Hepatitis B
    581 (BAX)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    581 (BAX)
   05165 Human papillomavirus infection
    581 (BAX)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    581 (BAX)
   01524 Platinum drug resistance
    581 (BAX)
   01522 Endocrine resistance
    581 (BAX)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    581 (BAX)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   581 (BAX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2
Motif
Other DBs
NCBI-GeneID: 581
NCBI-ProteinID: NP_620116
OMIM: 600040
HGNC: 959
Ensembl: ENSG00000087088
Vega: OTTHUMG00000160476
Pharos: Q07812(Tchem)
UniProt: Q07812
Structure
PDB: 

Position
19q13.33
AA seq 192 aa AA seqDB search
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggacgggtccggggagcagcccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatggggggg
gaggcacccgagctggccctggacccggtgcctcaggatgcgtccaccaagaagctgagc
gagtgtctcaagcgcatcggggacgaactggacagtaacatggagctgcagaggatgatt
gccgccgtggacacagactccccccgagaggtctttttccgagtggcagctgacatgttt
tctgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaactg
gtgctcaaggccctgtgcaccaaggtgccggaactgatcagaaccatcatgggctggaca
ttggacttcctccgggagcggctgttgggctggatccaagaccagggtggttgggacggc
ctcctctcctactttgggacgcccacgtggcagaccgtgaccatctttgtggcgggagtg
ctcaccgcctcactcaccatctggaagaagatgggctga

DBGET integrated database retrieval system