KEGG   Homo sapiens (human): 5816
Entry
5816              CDS       T01001                                 

Gene name
PVALB, D22S749
Definition
(RefSeq) parvalbumin
  KO
K23926  parvalbumin alpha
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    5816 (PVALB)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   5816 (PVALB)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8
Other DBs
NCBI-GeneID: 5816
NCBI-ProteinID: NP_001302461
OMIM: 168890
HGNC: 9704
Ensembl: ENSG00000100362
Vega: OTTHUMG00000150547
Pharos: P20472(Tbio)
UniProt: P20472 A0A024R1K9
Structure
PDB: 
1RK9 1RJV

Position
22q12.3
AA seq 110 aa
MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIE
EDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
NT seq 333 nt   +upstreamnt  +downstreamnt
atgtcgatgacagacttgctgaacgctgaggacatcaagaaggcggtgggagcctttagc
gctaccgactccttcgaccacaaaaagttcttccaaatggtcggcctgaagaaaaagagt
gcggatgatgtgaagaaggtgtttcacatgctggacaaggacaaaagtggcttcatcgag
gaggatgagctgggattcatcctaaaaggcttctccccagatgccagagacctgtctgct
aaagaaaccaagatgctgatggctgctggagacaaagatggggacggcaaaattggggtt
gacgaattctccactctggtggctgaaagctaa

DBGET integrated database retrieval system