KEGG   Homo sapiens (human): 5817Help
Entry
5817              CDS       T01001                                 

Gene name
PVR, CD155, HVED, NECL5, Necl-5, PVS, TAGE4
Definition
(RefSeq) poliovirus receptor
  KO
K06539  poliovirus receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    5817 (PVR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    5817 (PVR)
   04090 CD molecules [BR:hsa04090]
    5817 (PVR)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  Necl family
   5817 (PVR)
CD molecules [BR:hsa04090]
 Proteins
  5817 (PVR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2-set_2 Ig_3 ig V-set Ig_2 I-set CD34_antigen
Motif
Other DBs
NCBI-GeneID: 5817
NCBI-ProteinID: NP_006496
OMIM: 173850
HGNC: 9705
Ensembl: ENSG00000073008
Vega: OTTHUMG00000151527
Pharos: P15151(Tbio)
UniProt: P15151 A0A0C4DG49 A8K4I1
Structure
PDB: 

Position
19q13.31
AA seq 417 aa AA seqDB search
MARAMAAAWPLLLVALLVLSWPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTH
VSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGN
YTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWH
SDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTV
YYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIR
PVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRNAIIFLVLGILVFLILLG
IGIYFYWSKCSREVLWHCHLCPSSTEHASASANGHVSYSAVSRENSSSQDPQTEGTR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcccgagccatggccgccgcgtggccgctgctgctggtggcgctactggtgctgtcc
tggccacccccaggaaccggggacgtcgtcgtgcaggcgcccacccaggtgcccggcttc
ttgggcgactccgtgacgctgccctgctacctacaggtgcccaacatggaggtgacgcat
gtgtcacagctgacttgggcgcggcatggtgaatctggcagcatggccgtcttccaccaa
acgcagggccccagctattcggagtccaaacggctggaattcgtggcagccagactgggc
gcggagctgcggaatgcctcgctgaggatgttcgggttgcgcgtagaggatgaaggcaac
tacacctgcctgttcgtcacgttcccgcagggcagcaggagcgtggatatctggctccga
gtgcttgccaagccccagaacacagctgaggttcagaaggtccagctcactggagagcca
gtgcccatggcccgctgcgtctccacagggggtcgcccgccagcccaaatcacctggcac
tcagacctgggcgggatgcccaatacgagccaggtgccagggttcctgtctggcacagtc
actgtcaccagcctctggatattggtgccctcaagccaggtggacggcaagaatgtgacc
tgcaaggtggagcacgagagctttgagaagcctcagctgctgactgtgaacctcaccgtg
tactaccccccagaggtatccatctctggctatgataacaactggtaccttggccagaat
gaggccaccctgacctgcgatgctcgcagcaacccagagcccacaggctataattggagc
acgaccatgggtcccctgccaccctttgctgtggcccagggcgcccagctcctgatccgt
cctgtggacaaaccaatcaacacaactttaatctgcaacgtcaccaatgccctaggagct
cgccaggcagaactgaccgtccaggtcaaagagggacctcccagtgagcactcaggcatg
tcccgtaacgccatcatcttcctggttctgggaatcctggtttttctgatcctgctgggg
atcgggatttatttctattggtccaaatgttcccgtgaggtcctttggcactgtcatctg
tgtccctcgagtacagagcatgccagcgcctcagctaatgggcatgtctcctattcagct
gtgagcagagagaacagctcttcccaggatccacagacagagggcacaaggtga

DBGET integrated database retrieval system