KEGG   Homo sapiens (human): 5818Help
Entry
5818              CDS       T01001                                 

Gene name
NECTIN1, CD111, CLPED1, ED4, HIgR, HV1S, HVEC, OFC7, PRR, PRR1, PVRL1, PVRR, PVRR1, SK-12, nectin-1
Definition
(RefSeq) nectin cell adhesion molecule 1
  KO
K06081  poliovirus receptor-related protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04520  Adherens junction
hsa05168  Herpes simplex infection
Disease
H00516  Cleft lip and/or cleft palate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    5818 (NECTIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    5818 (NECTIN1)
 09160 Human Diseases
  09167 Infectious diseases
   05168 Herpes simplex infection
    5818 (NECTIN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    5818 (NECTIN1)
   04090 CD Molecules [BR:hsa04090]
    5818 (NECTIN1)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  Nectin family
   5818 (NECTIN1)
CD molecules [BR:hsa04090]
 Proteins
  5818 (NECTIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2-set_2 V-set Ig_3 Ig_2 ig I-set EphA2_TM
Motif
Other DBs
NCBI-GeneID: 5818
NCBI-ProteinID: NP_002846
OMIM: 600644
HGNC: 9706
Ensembl: ENSG00000110400
Vega: OTTHUMG00000166177
Pharos: Q15223(Tbio)
UniProt: Q15223
Structure
PDB: 

Position
11q23.3
AA seq 517 aa AA seqDB search
MARMGLAGAAGRWWGLALGLTAFFLPGVHSQVVQVNDSMYGFIGTDVVLHCSFANPLPSV
KITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEG
VYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDDKVLVATCTSANGKPP
SVVSWETRLKGEAEYQEIRNPNGTVTVISRYRLVPSREAHQQSLACIVNYHMDRFKESLT
LNVQYEPEVTIEGFDGNWYLQRMDVKLTCKADANPPATEYHWTTLNGSLPKGVEAQNRTL
FFKGPINYSLAGTYICEATNPIGTRSGQVEVNITEFPYTPSPPEHGRRAGPVPTAIIGGV
AGSILLVLIVVGGIVVALRRRRHTFKGDYSTKKHVYGNGYSKAGIPQHHPPMAQNLQYPD
DSDDEKKAGPLGGSSYEEEEEEEEGGGGGERKVGGPHPKYDEDAKRPYFTVDEAEARQDG
YGDRTLGYQYDPEQLDLAENMVSQNDGSFISKKEWYV
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggctcggatggggcttgcgggcgccgctggacgctggtggggactcgctctcggcttg
accgcattcttcctcccaggcgtccactcccaggtggtccaggtgaacgactccatgtat
ggcttcatcggcacagacgtggttctgcactgcagctttgccaacccgcttcccagcgtg
aagatcacccaggtcacatggcagaagtccaccaatggctccaagcagaacgtggccatc
tacaacccatccatgggcgtgtccgtgctggctccctaccgcgagcgtgtggaattcctg
cggccctccttcaccgatggcactatccgcctctcccgcctggagctggaggatgagggt
gtctacatctgcgagtttgctaccttccctacgggcaatcgagaaagccagctcaatctc
acggtgatggccaaacccaccaattggatagagggtacccaggcagtgcttcgagccaag
aaggggcaggatgacaaggtcctggtggccacctgcacctcagccaatgggaagcctccc
agtgtggtatcctgggaaactcggttaaaaggtgaggcagagtaccaggagatccggaac
cccaatggcacagtgacggtcatcagccgctaccgcctggtgcccagcagggaagcccac
cagcagtccttggcctgcatcgtcaactaccacatggaccgcttcaaggaaagcctcact
ctcaacgtgcagtatgagcctgaggtaaccattgaggggtttgatggcaactggtacctg
cagcggatggacgtgaagctcacctgcaaagctgatgctaaccccccagccactgagtac
cactggaccacgctaaatggctctctccccaagggtgtggaggcccagaacagaaccctc
ttcttcaagggacccatcaactacagcctggcagggacctacatctgtgaggccaccaac
cccatcggtacacgctcaggccaggtggaggtcaatatcacagaattcccctacaccccg
tctcctcccgaacatgggcggcgcgccgggccggtgcccacggccatcattgggggcgtg
gcggggagcatcctgctggtgttgattgtggtcggcgggatcgtggtcgccctgcgtcgg
cgccggcacaccttcaagggtgactacagcaccaagaagcacgtgtatggcaacggctac
agcaaggcaggcatcccccagcaccacccaccaatggcacagaacctgcagtaccccgac
gactcagacgacgagaagaaggccggcccactgggtggaagcagctatgaggaggaggag
gaggaggaggagggcggtggagggggcgagcgcaaggtgggcggcccccaccccaaatat
gacgaggacgccaagcggccctacttcaccgtggatgaggccgaggcccgtcaggacggc
tacggggaccggactctgggctaccagtacgaccctgagcagctggacttggctgagaac
atggtttctcagaacgacgggtctttcatttccaagaaggagtggtacgtgtag

DBGET integrated database retrieval system