KEGG   Homo sapiens (human): 5819Help
Entry
5819              CDS       T01001                                 

Gene name
NECTIN2, CD112, HVEB, PRR2, PVRL2, PVRR2
Definition
(RefSeq) nectin cell adhesion molecule 2
  KO
K06531  poliovirus receptor-related protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04520  Adherens junction
hsa05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    5819 (NECTIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    5819 (NECTIN2)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05168 Herpes simplex infection
    5819 (NECTIN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    5819 (NECTIN2)
   04090 CD molecules [BR:hsa04090]
    5819 (NECTIN2)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  Nectin family
   5819 (NECTIN2)
CD molecules [BR:hsa04090]
 Proteins
  5819 (NECTIN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2-set_2 ig Ig_3 V-set I-set Ig_2 TonB_C C1-set
Motif
Other DBs
NCBI-GeneID: 5819
NCBI-ProteinID: NP_001036189
OMIM: 600798
HGNC: 9707
Ensembl: ENSG00000130202
Vega: OTTHUMG00000180839
Pharos: Q92692(Tbio)
UniProt: Q92692
Structure
PDB: 

Position
19q13.32
AA seq 538 aa AA seqDB search
MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPV
PGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAEL
QDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTV
ALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKV
EHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTS
GTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG
IIGGIIAAIIATAVAATGILICRQQRKEQTLQGAEEDEDLEGPPSYKPPTPKAKLEAQEM
PSQLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTLEERSGPLHPGATSLGSPIPV
PPGPPAVEDVSLDLEDEEGEEEEEYLDKINPIYDALSYSSPSDSYQGKGFVMSRAMYV
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggccgctgccctcctgccgtcgagatcgccgccgacgccgctgctgtggccg
ctgctgctgctgctgctcctggaaaccggagcccaggatgtgcgagttcaagtgctaccc
gaggtgcgaggccagctcgggggcaccgtggagctgccgtgccacctgctgccacctgtt
cctggactgtacatctccctggtgacctggcagcgcccagatgcacctgcgaaccaccag
aatgtggccgccttccaccctaagatgggtcccagcttccccagcccgaagcctggcagc
gagcggctgtccttcgtctctgccaagcagagcactgggcaagacacagaggcagagctc
caggacgccacgctggccctccacgggctcacggtggaggacgagggcaactacacttgc
gagtttgccaccttccccaaggggtccgtccgagggatgacctggctcagagtcatagcc
aagcccaagaaccaagctgaggcccagaaggtcacgttcagccaggaccctacgacagtg
gccctctgcatctccaaagagggccgcccacctgcccggatctcctggctctcatccctg
gactgggaagccaaagagactcaggtgtcagggaccctggccggaactgtcactgtcacc
agccgcttcaccttggtgccctcgggccgagcagatggtgtcacggtcacctgcaaagtg
gagcatgagagcttcgaggaaccagccctgatacctgtgaccctctctgtacgctaccct
cctgaagtgtccatctccggctatgatgacaactggtacctcggccgtactgatgccacc
ctgagctgtgacgtccgcagcaacccagagcccacgggctatgactggagcacgacctca
ggcaccttcccgacctccgcagtggcccagggctcccagctggtcatccacgcagtggac
agtctgttcaataccaccttcgtctgcacagtcaccaatgccgtgggcatgggccgcgct
gagcaggtcatctttgtccgagagacccccaacacagcaggcgcaggggccacaggcggc
atcatcgggggcatcatcgccgccatcattgctactgctgtggctgccacgggcatcctt
atctgccggcagcagcggaaggagcagacgctgcagggggcagaggaggacgaagacctg
gagggacctccctcctacaagccaccgaccccaaaagcgaagctggaggcacaggagatg
ccctcccagctcttcactctgggggcctcggagcacagcccactcaagaccccctacttt
gatgctggcgcctcatgcactgagcaggaaatgcctcgataccatgagctgcccaccttg
gaagaacggtcaggacccttgcaccctggagccacaagcctggggtcccccatcccggtg
cctccagggccacctgctgtggaagacgtttccctggatctagaggatgaggagggggag
gaggaggaagagtatctggacaagatcaaccccatctatgatgctctgtcctatagcagc
ccctctgattcctaccagggcaaaggctttgtcatgtcccgggccatgtatgtgtga

DBGET integrated database retrieval system