KEGG   Homo sapiens (human): 5824Help
Entry
5824              CDS       T01001                                 

Gene name
PEX19, D1S2223E, HK33, PBD12A, PMP1, PMPI, PXF, PXMP1
Definition
(RefSeq) peroxisomal biogenesis factor 19
  KO
K13337  peroxin-19
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Disease
H00205  Peroxisome biogenesis disorder
H01342  Zellweger syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    5824 (PEX19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pex19 Cytochrom_NNT Rod-binding zf-C2HE Laminin_I GAS
Motif
Other DBs
NCBI-GeneID: 5824
NCBI-ProteinID: NP_002848
OMIM: 600279
HGNC: 9713
Ensembl: ENSG00000162735
Vega: OTTHUMG00000033112
Pharos: P40855(Tbio)
UniProt: P40855 A0A0S2Z497
Structure
PDB: 

Position
1q23.2
AA seq 299 aa AA seqDB search
MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAK
DALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMT
SQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQ
NLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDS
ETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQCLIM
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgctgaggaaggctgtagtgtcggggccgaagcggacagggaattggaggag
cttctggaaagtgctcttgatgatttcgataaagccaaaccctccccagcacccccttct
accaccacggcccctgatgcttcggggccccagaagagatcgccaggagacactgccaaa
gatgccctcttcgcttcccaagagaagtttttccaggaactattcgacagtgaactggct
tcccaagccactgcggagttcgagaaggcaatgaaggagttggctgaggaagaaccccac
ctggtggagcagttccaaaagctctcagaggctgcagggagagtgggcagtgatatgacc
tcccaacaagaattcacttcttgcctaaaggaaacactaagtggattagccaaaaatgcc
actgaccttcagaactccagcatgtcggaagaagagctgaccaaggccatggaggggcta
ggcatggacgaaggggatggggaagggaacatcctccccatcatgcagagtattatgcag
aacctactctccaaggatgtgctgtacccatcactgaaggagatcacagaaaagtatcca
gaatggttgcagagtcatcgggaatctctacctccagagcagtttgaaaaatatcaggag
cagcacagcgtcatgtgcaaaatatgtgagcagtttgaggcagagacccccacagacagt
gaaaccactcaaaaggctcgttttgagatggtgctggatcttatgcagcagctacaagat
ttaggccatcctccaaaagagctggctggagagatgcctcctggcctcaactttgacctg
gatgccctcaatctttcgggcccaccaggtgccagtggtgaacagtgtctgatcatgtga

DBGET integrated database retrieval system