KEGG   Homo sapiens (human): 5829Help
Entry
5829              CDS       T01001                                 

Gene name
PXN
Definition
(RefSeq) paxillin
  KO
K05760  paxillin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
Network
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00414  HCMV US27 to CXCR4-GNB/G-PLCB-PKC signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    5829 (PXN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5829 (PXN)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5829 (PXN)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    5829 (PXN)
   04062 Chemokine signaling pathway
    5829 (PXN)
 09160 Human Diseases
  09161 Cancers
   05205 Proteoglycans in cancer
    5829 (PXN)
   05203 Viral carcinogenesis
    5829 (PXN)
  09167 Infectious diseases
   05100 Bacterial invasion of epithelial cells
    5829 (PXN)
   05163 Human cytomegalovirus infection
    5829 (PXN)
   05165 Human papillomavirus infection
    5829 (PXN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Paxillin LIM
Motif
Other DBs
NCBI-GeneID: 5829
NCBI-ProteinID: NP_001074324
OMIM: 602505
HGNC: 9718
Ensembl: ENSG00000089159
Vega: OTTHUMG00000169169
Pharos: P49023(Tbio)
UniProt: P49023 A0A140VJQ8
Structure
PDB: 

Position
12q24.23
AA seq 591 aa AA seqDB search
MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNG
TILDPLDQWQPSSSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSF
PNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPL
YGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQG
EMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKIQGLEQRADGERCWAAGWPRDGG
RSSPGGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGA
CKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYC
NGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCA
RAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQK
PITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggacgacctcgacgccctgctggcggacttggagtctaccacctcccacatctccaaa
cggcctgtgttcttgtcggaggagaccccctactcatacccaactggaaaccacacatac
caggagattgccgtgccaccccccgtccccccacccccgtccagcgaggccctcaatggc
acaatccttgaccccttagaccagtggcagcccagcagctcccgattcatccaccagcag
cctcagtcctcatcacctgtgtacggctccagtgccaaaacttccagtgtctccaaccct
caggacagtgttggctctccgtgctcccgagtgggtgaggaggagcacgtctacagcttc
cccaacaagcagaaatcagctgagccttcacccaccgtaatgagcacgtccctgggcagc
aacctttctgaactcgaccgcctgctgctggaactgaacgctgtacagcataacccgcca
ggcttccctgcagatgaggccaactcaagccccccgcttcctggggccctgagccccctc
tatggtgtcccagagactaacagccccttgggaggcaaagctgggcccctgacgaaagag
aagcctaagcggaatgggggccggggcctggaggacgtgcggcccagtgtggagagtctc
ttggatgaactggagagctccgtgcccagccccgtccctgccatcactgtgaaccagggc
gagatgagcagcccgcagcgcgtcacctccacccaacagcagacacgcatctcggcctcc
tctgccaccagggagctggacgagctgatggcttcgctgtcggatttcaagatccagggc
ctggagcaaagagcggatggggagcggtgctgggcggccggctggcctcgggacggcggg
cggagcagccccggagggcaggacgagggagggttcatggcccaggggaagacagggagc
agctcaccccctggggggcccccgaagcccgggagccagctggacagcatgctggggagc
ctgcagtctgacctgaacaagctgggggtcgccacagtcgccaaaggagtctgcggggcc
tgcaagaagcccatcgccgggcaggttgtgaccgccatggggaagacgtggcaccccgag
cacttcgtctgcacccactgccaggaggagatcggatcccggaacttcttcgagcgggat
ggacagccctactgtgaaaaggactaccacaacctcttctccccgcgctgctactactgc
aacggccccatcctggataaagtggtgacagcccttgaccggacgtggcaccctgaacac
ttcttctgtgcacagtgtggagccttctttggtcccgaagggttccacgagaaggacggc
aaggcctactgtcgcaaggactacttcgacatgttcgcacccaagtgtggcggctgcgcc
cgggccatcctggagaactatatctcagccctcaacacgctgtggcatcctgagtgcttt
gtgtgccgggaatgcttcacgccattcgtgaacggcagcttcttcgagcacgacgggcag
ccctactgtgaggtgcactaccacgagcggcgcggctcgctgtgttctggctgccagaag
cccatcaccggccgctgcatcaccgccatggccaagaagttccaccccgagcacttcgtc
tgtgccttctgcctcaagcagctcaacaagggcaccttcaaggagcagaacgacaagcct
tactgtcagaactgcttcctcaagctcttctgctag

DBGET integrated database retrieval system