KEGG   Homo sapiens (human): 5831Help
Entry
5831              CDS       T01001                                 

Gene name
PYCR1, ARCL2B, ARCL3B, P5C, P5CR, PIG45, PP222, PRO3, PYCR
Definition
(RefSeq) pyrroline-5-carboxylate reductase 1
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
hsa01230  Biosynthesis of amino acids
Module
hsa_M00015  Proline biosynthesis, glutamate => proline
Disease
H00557  Cutis laxa
H00558  Geroderma osteodysplasticum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    5831 (PYCR1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     5831 (PYCR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_Gly3P_dh_N Rossmann-like ApbA
Motif
Other DBs
NCBI-GeneID: 5831
NCBI-ProteinID: NP_001269209
OMIM: 179035
HGNC: 9721
Ensembl: ENSG00000183010
Vega: OTTHUMG00000178436
Pharos: P32322(Tbio)
UniProt: P32322 A0A024R8U9
Structure
PDB: 

Position
17q25.3
AA seq 319 aa AA seqDB search
MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETV
QHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRC
MTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAY
AFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIH
ALHVLESGGFRSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKVKLDSPAGTAL
SPSGHTKLLPRSLAPAGKD
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgggcttcatcggcgctggccagctggcttttgccctggccaagggcttcaca
gcagcaggcgtcttggctgcccacaagataatggctagctccccagacatggacctggcc
acagtttctgctctcaggaagatgggggtgaagttgacaccccacaacaaggagacggtg
cagcacagtgatgtgctcttcctggctgtgaagccacacatcatccccttcatcctggat
gaaataggcgccgacattgaggacagacacattgtggtgtcctgcgcggccggcgtcacc
atcagctccattgagaagaagctgtcagcgtttcggccagcccccagggtcatccgctgc
atgaccaacactccagtcgtggtgcgggagggggccaccgtgtatgccacaggcacgcac
gcccaggtggaggacgggaggctcatggagcagctgctgagcagcgtgggcttctgcacg
gaggtggaagaggacctgattgatgccgtcacggggctcagtggcagcggccccgcctac
gcattcacagccctggatgccctggctgatgggggtgtgaagatgggacttccaaggcgc
ctggcagtccgcctcggggcccaggccctcctgggggctgccaagatgctgctgcactca
gaacagcacccaggccagctcaaggacaacgtcagctctcctggtggggccaccatccat
gccttgcatgtgctggagagtgggggcttccgctccctgctcatcaacgctgtggaggcc
tcctgcatccgcacacgggagctgcagtccatggctgaccaggagcaggtgtcaccagcc
gccatcaagaagaccatcctggacaaggtgaagctggactcccctgcagggaccgctctg
tcgccttctggccacaccaagctgctcccccgcagcctggccccagcgggcaaggattga

DBGET integrated database retrieval system