KEGG   Homo sapiens (human): 5834Help
Entry
5834              CDS       T01001                                 

Gene name
PYGB, GPBB
Definition
(RefSeq) glycogen phosphorylase B
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
hsa04217  Necroptosis
hsa04910  Insulin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
Drug target
Ingliforib: D04537
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    5834 (PYGB)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    5834 (PYGB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5834 (PYGB)
   04922 Glucagon signaling pathway
    5834 (PYGB)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    5834 (PYGB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     5834 (PYGB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphorylase
Motif
Other DBs
NCBI-GeneID: 5834
NCBI-ProteinID: NP_002853
OMIM: 138550
HGNC: 9723
Ensembl: ENSG00000100994
Vega: OTTHUMG00000032117
Pharos: P11216(Tbio)
UniProt: P11216
Structure
PDB: 

Position
20p11.21
AA seq 843 aa AA seqDB search
MAKPLTDSEKRKQISVRGLAGLGDVAEVRKSFNRHLHFTLVKDRNVATPRDYFFALAHTV
RDHLVGRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTMVNLGLQNACDEAIYQLGLDL
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKIVNGWQVEEA
DDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAMPYDTPVPGYKNNTVN
TMRLWSAKAPNDFKLQDFNVGDYIEAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKSSKFGCRDPVRTCFETFPDKVAIQLNDTHPALSIPELMRILVDVEKV
DWDKAWEITKKTCAYTNHTVLPEALERWPVSMFEKLLPRHLEIIYAINQRHLDHVAALFP
GDVDRLRRMSVIEEGDCKRINMAHLCVIGSHAVNGVARIHSEIVKQSVFKDFYELEPEKF
QNKTNGITPRRWLLLCNPGLADTIVEKIGEEFLTDLSQLKKLLPLVSDEVFIRDVAKVKQ
ENKLKFSAFLEKEYKVKINPSSMFDVHVKRIHEYKRQLLNCLHVVTLYNRIKRDPAKAFV
PRTVMIGGKAAPGYHMAKLIIKLVTSIGDVVNHDPVVGDRLKVIFLENYRVSLAEKVIPA
ADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGAENLFIFGLRVEDVE
ALDRKGYNAREYYDHLPELKQAVDQISSGFFSPKEPDCFKDIVNMLMHHDRFKVFADYEA
YMQCQAQVDQLYRNPKEWTKKVIRNIACSGKFSSDRTITEYAREIWGVEPSDLQIPPPNI
PRD
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagccgctgacggacagcgagaagcggaagcagatcagcgtgcgcggcctggcg
gggctaggcgacgtggccgaggtgcggaagagcttcaaccggcacttgcacttcacgctg
gtcaaggaccgcaatgtggccacgccccgcgactacttcttcgcgctggcgcacacggtg
cgcgaccacctcgtgggccgctggatccgcacgcagcagcactactacgagcgcgacccc
aagcgcatttattatctttccctggaattctacatgggtcgcacgctgcagaacacgatg
gtgaacctgggccttcagaatgcctgcgatgaagccatctatcagttggggttagacttg
gaggaactcgaggagatagaagaagatgctggccttgggaatggaggcctggggaggctg
gcagcgtgtttccttgactcaatggctaccttgggcctggcagcatacggctatggaatc
cgctatgaatttgggatttttaaccagaagattgtcaatggctggcaggtagaggaggcc
gatgactggctgcgctacggcaacccctgggagaaagcgcggcctgagtatatgcttccc
gtgcacttctacggacgcgtggagcacacccccgacggcgtgaagtggctggacacacag
gtggtgctggccatgccctacgacaccccagtgcccggctacaagaacaacaccgtcaac
accatgcggctgtggtccgccaaggctcccaacgacttcaagctgcaggacttcaacgtg
ggagactacatcgaggcggtcctggaccggaacttggctgagaacatctccagggtcctg
tatccaaatgataacttctttgaggggaaggagctgcggctgaagcaggagtacttcgtg
gtggccgccacgctccaggacatcatccgccgcttcaagtcgtccaagttcggctgccgg
gaccctgtgagaacctgtttcgagacgttcccagacaaggtggccatccagctgaacgac
acccaccccgccctctccatccctgagctcatgcggatcctggtggacgtggagaaggtg
gactgggacaaggcctgggaaatcacgaagaagacctgtgcatacaccaaccacactgtg
ctgcctgaggccttggagcgctggcccgtgtccatgtttgagaagctgctgccgcggcac
ctggagataatctatgccatcaaccagcggcacctggaccacgtggccgcgctgtttccc
ggcgatgtggaccgcctgcgcaggatgtctgtgatcgaggagggggactgcaagcggatc
aacatggcccacctgtgtgtgattgggtcccatgctgtcaatggtgtggcgaggatccac
tcggagatcgtgaaacagtcggtctttaaggatttttatgaactggagccagagaagttc
cagaataagaccaatggcatcaccccccgccggtggctgctgctgtgcaacccggggctg
gccgataccatcgtggagaaaattggggaggagttcctgactgacctgagccagctgaag
aagctgctgccgctggtcagtgacgaggtgttcatcagggacgtggccaaggtcaaacag
gagaacaagctcaagttctcggccttcctggagaaggagtacaaggtgaagatcaacccc
tcctccatgttcgatgtgcatgtgaagaggatccacgagtacaagcggcagctgctcaac
tgcctgcacgtcgtcaccctgtacaatcgaatcaagagagacccggccaaggcttttgtg
cccaggactgttatgattgggggcaaggcagcgcccggttaccacatggccaagctgatc
atcaagttggtcacctccatcggcgacgtcgtcaatcatgacccagttgtgggtgacagg
ttgaaagtgatcttcctggagaactaccgtgtgtccttggctgagaaagtgatcccggcc
gctgatctgtcgcagcagatctccactgcaggcaccgaggcctcaggcacaggcaacatg
aagttcatgctcaacggggccctcaccatcggcaccatggacggcgccaacgtggagatg
gccgaggaggccggggccgagaacctcttcatcttcggcctgcgggtggaggatgtcgag
gccttggaccggaaagggtacaatgccagggagtactacgaccacctgcccgagctgaag
caggccgtggaccagatcagcagtggctttttttctcccaaggagccagactgcttcaag
gacatcgtgaacatgctgatgcaccatgacaggttcaaggtgtttgcagactatgaagcc
tacatgcagtgccaggcacaggtggaccagctgtaccggaaccccaaggagtggaccaag
aaggtcatcaggaacatcgcctgctcgggcaagttctccagtgaccggaccatcacggag
tatgcacgggagatctggggtgtggagccctccgacctgcagatcccgccccccaacatc
ccccgggactag

DBGET integrated database retrieval system