KEGG   Homo sapiens (human): 5834Help
Entry
5834              CDS       T01001                                 

Gene name
PYGB, GPBB
Definition
(RefSeq) glycogen phosphorylase B
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
hsa04217  Necroptosis
hsa04910  Insulin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
Module
hsa_M00855  Glycogen degradation, glycogen => glucose-6P
Network
nt06017  Glycogen metabolism
  Element
N00718  Glycogen degradation
N00719  G6PC deficiency in glycogen degradation
Drug target
Ingliforib: D04537
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    5834 (PYGB)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    5834 (PYGB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5834 (PYGB)
   04922 Glucagon signaling pathway
    5834 (PYGB)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    5834 (PYGB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     5834 (PYGB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphorylase TPR_22
Motif
Other DBs
NCBI-GeneID: 5834
NCBI-ProteinID: NP_002853
OMIM: 138550
HGNC: 9723
Ensembl: ENSG00000100994
Vega: OTTHUMG00000032117
Pharos: P11216(Tbio)
UniProt: P11216
Structure
PDB: 

Position
20p11.21
AA seq 843 aa AA seqDB search
MAKPLTDSEKRKQISVRGLAGLGDVAEVRKSFNRHLHFTLVKDRNVATPRDYFFALAHTV
RDHLVGRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTMVNLGLQNACDEAIYQLGLDL
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKIVNGWQVEEA
DDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAMPYDTPVPGYKNNTVN
TMRLWSAKAPNDFKLQDFNVGDYIEAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKSSKFGCRDPVRTCFETFPDKVAIQLNDTHPALSIPELMRILVDVEKV
DWDKAWEITKKTCAYTNHTVLPEALERWPVSMFEKLLPRHLEIIYAINQRHLDHVAALFP
GDVDRLRRMSVIEEGDCKRINMAHLCVIGSHAVNGVARIHSEIVKQSVFKDFYELEPEKF
QNKTNGITPRRWLLLCNPGLADTIVEKIGEEFLTDLSQLKKLLPLVSDEVFIRDVAKVKQ
ENKLKFSAFLEKEYKVKINPSSMFDVHVKRIHEYKRQLLNCLHVVTLYNRIKRDPAKAFV
PRTVMIGGKAAPGYHMAKLIIKLVTSIGDVVNHDPVVGDRLKVIFLENYRVSLAEKVIPA
ADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGAENLFIFGLRVEDVE
ALDRKGYNAREYYDHLPELKQAVDQISSGFFSPKEPDCFKDIVNMLMHHDRFKVFADYEA
YMQCQAQVDQLYRNPKEWTKKVIRNIACSGKFSSDRTITEYAREIWGVEPSDLQIPPPNI
PRD
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagccgctgacggacagcgagaagcggaagcagatcagcgtgcgcggcctggcg
gggctaggcgacgtggccgaggtgcggaagagcttcaaccggcacttgcacttcacgctg
gtcaaggaccgcaatgtggccacgccccgcgactacttcttcgcgctggcgcacacggtg
cgcgaccacctcgtgggccgctggatccgcacgcagcagcactactacgagcgcgacccc
aagcgcatttattatctttccctggaattctacatgggtcgcacgctgcagaacacgatg
gtgaacctgggccttcagaatgcctgcgatgaagccatctatcagttggggttagacttg
gaggaactcgaggagatagaagaagatgctggccttgggaatggaggcctggggaggctg
gcagcgtgtttccttgactcaatggctaccttgggcctggcagcatacggctatggaatc
cgctatgaatttgggatttttaaccagaagattgtcaatggctggcaggtagaggaggcc
gatgactggctgcgctacggcaacccctgggagaaagcgcggcctgagtatatgcttccc
gtgcacttctacggacgcgtggagcacacccccgacggcgtgaagtggctggacacacag
gtggtgctggccatgccctacgacaccccagtgcccggctacaagaacaacaccgtcaac
accatgcggctgtggtccgccaaggctcccaacgacttcaagctgcaggacttcaacgtg
ggagactacatcgaggcggtcctggaccggaacttggctgagaacatctccagggtcctg
tatccaaatgataacttctttgaggggaaggagctgcggctgaagcaggagtacttcgtg
gtggccgccacgctccaggacatcatccgccgcttcaagtcgtccaagttcggctgccgg
gaccctgtgagaacctgtttcgagacgttcccagacaaggtggccatccagctgaacgac
acccaccccgccctctccatccctgagctcatgcggatcctggtggacgtggagaaggtg
gactgggacaaggcctgggaaatcacgaagaagacctgtgcatacaccaaccacactgtg
ctgcctgaggccttggagcgctggcccgtgtccatgtttgagaagctgctgccgcggcac
ctggagataatctatgccatcaaccagcggcacctggaccacgtggccgcgctgtttccc
ggcgatgtggaccgcctgcgcaggatgtctgtgatcgaggagggggactgcaagcggatc
aacatggcccacctgtgtgtgattgggtcccatgctgtcaatggtgtggcgaggatccac
tcggagatcgtgaaacagtcggtctttaaggatttttatgaactggagccagagaagttc
cagaataagaccaatggcatcaccccccgccggtggctgctgctgtgcaacccggggctg
gccgataccatcgtggagaaaattggggaggagttcctgactgacctgagccagctgaag
aagctgctgccgctggtcagtgacgaggtgttcatcagggacgtggccaaggtcaaacag
gagaacaagctcaagttctcggccttcctggagaaggagtacaaggtgaagatcaacccc
tcctccatgttcgatgtgcatgtgaagaggatccacgagtacaagcggcagctgctcaac
tgcctgcacgtcgtcaccctgtacaatcgaatcaagagagacccggccaaggcttttgtg
cccaggactgttatgattgggggcaaggcagcgcccggttaccacatggccaagctgatc
atcaagttggtcacctccatcggcgacgtcgtcaatcatgacccagttgtgggtgacagg
ttgaaagtgatcttcctggagaactaccgtgtgtccttggctgagaaagtgatcccggcc
gctgatctgtcgcagcagatctccactgcaggcaccgaggcctcaggcacaggcaacatg
aagttcatgctcaacggggccctcaccatcggcaccatggacggcgccaacgtggagatg
gccgaggaggccggggccgagaacctcttcatcttcggcctgcgggtggaggatgtcgag
gccttggaccggaaagggtacaatgccagggagtactacgaccacctgcccgagctgaag
caggccgtggaccagatcagcagtggctttttttctcccaaggagccagactgcttcaag
gacatcgtgaacatgctgatgcaccatgacaggttcaaggtgtttgcagactatgaagcc
tacatgcagtgccaggcacaggtggaccagctgtaccggaaccccaaggagtggaccaag
aaggtcatcaggaacatcgcctgctcgggcaagttctccagtgaccggaccatcacggag
tatgcacgggagatctggggtgtggagccctccgacctgcagatcccgccccccaacatc
ccccgggactag

KEGG   Homo sapiens (human): 5836Help
Entry
5836              CDS       T01001                                 

Gene name
PYGL, GSD6
Definition
(RefSeq) glycogen phosphorylase L
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
hsa04217  Necroptosis
hsa04910  Insulin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
Module
hsa_M00855  Glycogen degradation, glycogen => glucose-6P
Network
nt06017  Glycogen metabolism
  Element
N00718  Glycogen degradation
N00719  G6PC deficiency in glycogen degradation
N00723  PYGL deficiency in glycogen degradation
Disease
H00069  Glycogen storage disease
H01760  Hepatic glycogen storage disease
H01944  Glycogen storage disease type VI
Drug target
Ingliforib: D04537
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    5836 (PYGL)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    5836 (PYGL)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5836 (PYGL)
   04922 Glucagon signaling pathway
    5836 (PYGL)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    5836 (PYGL)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     5836 (PYGL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphorylase
Motif
Other DBs
NCBI-GeneID: 5836
NCBI-ProteinID: NP_002854
OMIM: 613741
HGNC: 9725
Ensembl: ENSG00000100504
Vega: OTTHUMG00000166596
Pharos: P06737(Tchem)
UniProt: P06737
Structure
PDB: 

Position
14q22.1
AA seq 847 aa AA seqDB search
MAKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTV
RDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDI
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEA
DDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVN
TMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKL
PWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFP
KDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKF
QNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQ
ENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFV
PRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPA
TDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVA
ALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEA
YVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSNE
SNKVNGN
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcccctgacggaccaggagaagcggcggcagatcagcatccgcggcatcgtg
ggcgtggagaacgtggcagagctgaagaagagtttcaaccggcacctgcacttcacgctg
gtcaaggaccgcaacgtggccaccacccgcgactactacttcgcgctggcgcacacggtg
cgcgaccacctggtggggcgctggatccgcacgcagcagcactactacgacaagtgcccc
aagagggtatattacctctctctggaattttacatgggccgaacattacagaacaccatg
atcaacctcggtctgcaaaatgcctgtgatgaggccatttaccagcttggattggatata
gaagagttagaagaaattgaagaagatgctggacttggcaatggtggtcttgggagactt
gctgcctgcttcttggattccatggcaaccctgggacttgcagcctatggatacggcatt
cggtatgaatatgggattttcaatcagaagatccgagatggatggcaggtagaagaagca
gatgattggctcagatatggaaacccttgggagaagtcccgcccagaattcatgctgcct
gtgcacttctatggaaaagtagaacacaccaacaccgggaccaagtggattgacactcaa
gtggtcctggctctgccatatgacacccccgtgcccggctacatgaataacactgtcaac
accatgcgcctctggtctgctcgggcaccaaatgactttaacctcagagactttaatgtt
ggagactacattcaggctgtgctggaccgaaacctggccgagaacatctcccgggtcctc
tatcccaatgacaatttttttgaagggaaggagctaagattgaagcaggaatactttgtg
gtggctgcaaccttgcaagatatcatccgccgtttcaaagcctccaagtttggctccacc
cgtggtgcaggaactgtgtttgatgccttcccggatcaggtggccatccagctgaatgac
actcaccctgcactcgcgatccctgagctgatgaggatttttgtggatattgaaaaactg
ccctggtccaaggcatgggagctcacccagaagaccttcgcctacaccaaccacacagtg
ctcccggaagccctggagcgctggcccgtggacctggtggagaagctgctccctcgacat
ttggaaatcatttatgagataaatcagaagcatttagatagaattgtggccttgtttcct
aaagatgtggaccgtctgagaaggatgtctctgatagaagaggaaggaagcaaaaggatc
aacatggcccatctctgcattgtcggttcccatgctgtgaatggcgtggctaaaatccac
tcagacatcgtgaagactaaagtattcaaggacttcagtgagctagaacctgacaagttt
cagaataaaaccaatgggatcactccaaggcgctggctcctactctgcaacccaggactt
gcagagctcatagcagagaaaattggagaagactatgtgaaagacctgagccagctgacg
aagctccacagcttcctgggtgatgatgtcttcctccgggaactcgccaaggtgaagcag
gagaataagctgaagttttctcagttcctggagacggagtacaaagtgaagatcaaccca
tcctccatgtttgatgtccaggtgaagaggatacatgagtacaagcgacagctcttgaac
tgtctgcatgtgatcacgatgtacaaccgcattaagaaagaccctaagaagttattcgtg
ccaaggacagttatcattggtggtaaagctgccccaggatatcacatggccaaaatgatc
ataaagctgatcacttcagtggcagatgtggtgaacaatgaccctatggttggaagcaag
ttgaaagtcatcttcttggagaactacagagtatctcttgctgaaaaagtcattccagcc
acagatctgtcagagcagatttccactgcaggcaccgaagcctcggggacaggcaatatg
aagttcatgctaaatggggccctaactatcgggaccatggatggggccaatgtggaaatg
gcagaagaagctggggaagagaacctgttcatctttggcatgaggatagatgatgtggct
gctttggacaagaaagggtacgaggcaaaagaatactatgaggcacttccagagctgaag
ctggtcattgatcaaattgacaatggctttttttctcccaagcagcctgacctcttcaaa
gatatcatcaacatgctattttatcatgacaggtttaaagtctttgcagactacgaagcc
tatgtcaagtgtcaagataaagtgagtcagctgtacatgaatccaaaggcctggaacaca
atggtactcaaaaacatagctgcctcggggaaattctccagtgaccgaacaattaaagaa
tatgcccaaaacatctggaacgtggaaccttcagatctaaagatttctctatccaatgaa
tctaacaaagtcaatggaaattga

KEGG   Homo sapiens (human): 5837Help
Entry
5837              CDS       T01001                                 

Gene name
PYGM
Definition
(RefSeq) glycogen phosphorylase, muscle associated
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
hsa04217  Necroptosis
hsa04910  Insulin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
Module
hsa_M00855  Glycogen degradation, glycogen => glucose-6P
Network
nt06017  Glycogen metabolism
  Element
N00718  Glycogen degradation
N00719  G6PC deficiency in glycogen degradation
N00722  PYGM deficiency in glycogen degradation
Disease
H00069  Glycogen storage disease
H01762  Muscle glycogen storage disease
H01943  Glycogen storage disease type V
Drug target
Ingliforib: D04537
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    5837 (PYGM)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    5837 (PYGM)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5837 (PYGM)
   04922 Glucagon signaling pathway
    5837 (PYGM)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    5837 (PYGM)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     5837 (PYGM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphorylase TPR_22 COX_ARM
Motif
Other DBs
NCBI-GeneID: 5837
NCBI-ProteinID: NP_005600
OMIM: 608455
HGNC: 9726
Ensembl: ENSG00000068976
Vega: OTTHUMG00000066835
Pharos: P11217(Tchem)
UniProt: P11217
Structure
PDB: 

Position
11q13.1
AA seq 842 aa AA seqDB search
MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTV
RDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDM
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKISGGWQMEEA
DDWLRYGNPWEKARPEFTLPVHFYGHVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVN
TMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRILVDLERM
DWDKAWDVTVRTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFP
GDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKF
QNKTNGITPRRWLVLCNPGLAEVIAERIGEDFISDLDQLRKLLSFVDDEAFIRDVAKVKQ
ENKLKFAAYLEREYKVHINPNSLFDIQVKRIHEYKRQLLNCLHVITLYNRIKREPNKFFV
PRTVMIGGKAAPGYHMAKMIIRLVTAIGDVVNHDPAVGDRLRVIFLENYRVSLAEKVIPA
ADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVD
KLDQRGYNAQEYYDRIPELRQVIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYED
YIKCQEKVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDE
AI
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggcccctgtcagaccaagagaaaagaaagcaaatcagtgtgcgtggcctggcc
ggcgtggagaacgtgactgagctgaaaaagaacttcaaccggcacctgcatttcacactc
gtaaaggaccgcaatgtggccaccccacgagactactactttgctctggcccataccgtg
cgcgaccacctcgtggggcgctggatccgcacgcagcagcactactatgagaaggacccc
aagaggatctactacctgtctttagagttctatatgggacggacgctacagaacaccatg
gtgaacctggccttagagaatgcctgtgacgaggccacctaccagctgggcctggacatg
gaggagctggaggaaattgaggaggatgcggggctgggcaacgggggcctgggccggctg
gcagcctgctttcttgactccatggcaacactgggcctggccgcctatggctacgggatt
cgctatgagtttgggatttttaaccagaagatctccgggggctggcagatggaggaggcc
gatgactggcttcgctacggcaacccctgggagaaggcccggcccgagttcacgctacct
gtgcacttctacggccatgtggagcacaccagccagggtgccaagtgggtggacacacag
gtggtactggccatgccctacgatacgcccgtgcctggctatcgcaacaatgttgtcaac
accatgcgcctctggtctgccaaggctcccaatgacttcaacctcaaggacttcaatgtc
ggtggctacatccaggctgtgttggaccgaaacctggcggagaacatctctcgtgtcctg
taccccaatgataatttcttcgaagggaaggagctgcggctgaagcaggagtatttcgtg
gtggctgccaccctccaggacatcatccgtcgcttcaagtcttccaagttcggctgccgt
gatcccgtgcgcacgaacttcgatgccttcccagataaggtggccatccagctcaatgac
acccacccctccctggccatccccgagctgatgaggatcctggtggacctggaacggatg
gactgggacaaggcgtgggatgtgacagtgaggacctgtgcctacaccaaccacacggtg
ctgcccgaggccctggagcgctggccggtgcacctcttggagacgctgctgccgcggcac
ctccagatcatctacgagatcaaccagcgcttcctcaaccgggtggcggccgcattccca
ggggacgtagaccggctgcggcgcatgtcgctggtggaggagggcgcagtgaagcgcatc
aacatggcacacctgtgcatcgcggggtcgcacgccgtcaacggcgtggcgcgcatccac
tccgagatcctcaagaagaccatcttcaaagacttctatgagctggagcctcataagttc
cagaataagaccaacggcatcacccctcggcgctggctggttctgtgtaaccccgggctg
gcagaggtcattgctgagcgcatcggggaggacttcatctctgacctggaccagctgcgc
aaactgctctcctttgtggatgatgaagctttcattcgggatgtggccaaagtgaagcag
gaaaacaagttgaagtttgctgcctacctagagagggaatacaaagtccacatcaacccc
aactcactcttcgacatccaggtgaagcggattcacgaatataaacgacagctcctcaac
tgcctccatgtcatcaccctgtacaaccgcatcaagagggagcccaataagttttttgtg
cctcggactgtgatgattggagggaaggctgcacctgggtaccacatggccaagatgatc
atcagactcgtcacagccatcggggatgtggtcaaccatgacccggcagtgggtgaccgc
ctccgtgtcatcttcctggagaactaccgagtctcactggccgagaaagtgatcccagct
gcagacctctctgagcagatctccactgcgggcactgaagcctcaggcaccggcaacatg
aagttcatgctcaacggggctctgaccattggcaccatggacggggccaatgtggagatg
gcagaagaggcgggagaggaaaacttcttcatctttggcatgcgggtggaggatgtggat
aagcttgaccaaagagggtacaatgcccaggagtactacgatcgcattcctgagcttcgg
caggtcattgagcagctgagcagtggcttcttctcccccaaacagcccgacctgttcaag
gacattgtcaatatgctcatgcaccatgaccggtttaaagtcttcgcagattatgaagac
tacattaaatgccaggagaaagtcagcgccttgtacaagaacccaagagagtggacgcgg
atggtgatccggaacatagccacctctggcaagttctccagtgaccgcaccattgcccag
tatgcccgggagatctggggtgtggagccttcccgccagcgcctgccagccccggatgag
gccatctga

DBGET integrated database retrieval system