KEGG   Homo sapiens (human): 58480Help
Entry
58480             CDS       T01001                                 

Gene name
RHOU, ARHU, CDC42L1, G28K, WRCH1, hG28K
Definition
(RefSeq) ras homolog family member U
  KO
K07865  Ras homolog gene family, member U
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    58480 (RHOU)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    58480 (RHOU)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    58480 (RHOU)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    58480 (RHOU)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Lipase_GDSL_3 AAA_16 AAA_7 Abhydrolase_2 SLBP_RNA_bind
Motif
Other DBs
NCBI-GeneID: 58480
NCBI-ProteinID: NP_067028
OMIM: 606366
HGNC: 17794
Ensembl: ENSG00000116574
Vega: OTTHUMG00000037919
Pharos: Q7L0Q8(Tbio)
UniProt: Q7L0Q8 A0A024R3Q7
Structure
PDB: 

Position
1q42.13
AA seq 258 aa AA seqDB search
MPPQQGDPAFPDRCEAPPVPPRRERGGRGGRGPGEPGGRGRAGGAEGRGVKCVLVGDGAV
GKTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFDKLRPLCYTN
TDIFLLCFSVVSPSSFQNVSEKWVPEIRCHCPKAPIILVGTQSDLREDVKVLIELDKCKE
KPVPEEAAKLCAEEIKAASYIECSALTQKNLKEVFDAAIVAGIQYSDTQQQPKKSKSRTP
DKMKNLSKSWWKKYCCFV
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcccccgcagcagggggaccccgcgttccccgaccgctgcgaggcgcctccggtgccg
ccgcgtcgggagcgcggtggacgcgggggacgcgggcctggggagccggggggccggggg
cgtgcggggggtgccgaggggcgcggcgtcaagtgcgtgctggtcggcgacggcgcggtg
ggcaagacgagcctggtggtgagctacaccaccaacggctaccccaccgagtacatccct
actgccttcgacaacttctccgcggtggtgtctgtggatgggcggcccgtgagactccaa
ctctgtgacactgccggacaggatgaatttgacaagctgaggcctctctgctacaccaac
acagacatcttcctgctctgcttcagtgtcgtgagcccctcatccttccagaacgtcagt
gagaaatgggtgccggagattcgatgccactgtcccaaagcccccatcatcctagttgga
acgcagtcggatctcagagaagatgtcaaagtcctcattgagttggacaaatgcaaagaa
aagccagtgcctgaagaggcggctaagctgtgcgccgaggaaatcaaagccgcctcctac
atcgagtgttcagccttgactcaaaaaaacctcaaagaggtctttgatgcagccatcgtc
gctggcattcaatactcggacactcagcaacagccaaagaagtctaaaagcaggactcca
gataaaatgaaaaacctctccaagtcctggtggaagaagtactgctgtttcgtatga

DBGET integrated database retrieval system