KEGG   Homo sapiens (human): 58484Help
Entry
58484             CDS       T01001                                 

Gene name
NLRC4, AIFEC, CARD12, CLAN, CLAN1, CLANA, CLANB, CLANC, CLAND, CLR2.1, FCAS4, IPAF
Definition
(RefSeq) NLR family CARD domain containing 4
  KO
K12805  NLR family CARD domain-containing protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05132  Salmonella infection
hsa05134  Legionellosis
Disease
H01748  Autoinflammation with infantile enterocolitis (AIFEC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    58484 (NLRC4)
 09160 Human Diseases
  09167 Infectious diseases
   05132 Salmonella infection
    58484 (NLRC4)
   05134 Legionellosis
    58484 (NLRC4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    58484 (NLRC4)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   58484 (NLRC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT CARD AAA_16 AAA_29
Motif
Other DBs
NCBI-GeneID: 58484
NCBI-ProteinID: NP_001186067
OMIM: 606831
HGNC: 16412
Ensembl: ENSG00000091106
Vega: OTTHUMG00000152107
Pharos: Q9NPP4(Tbio)
UniProt: Q9NPP4
Position
2p22.3
AA seq 1024 aa AA seqDB search
MNFIKDNSRALIQRMGMTVIKQITDDLFVWNVLNREEVNIICCEKVEQDAARGIIHMILK
KGSESCNLFLKSLKEWNYPLFQDLNGQSLFHQTSEGDLDDLAQDLKDLYHTPSFLNFYPL
GEDIDIIFNLKSTFTEPVLWRKDQHHHRVEQLTLNGLLQALQSPCIIEGESGKGKSTLLQ
RIAMLWGSGKCKALTKFKFVFFLRLSRAQGGLFETLCDQLLDIPGTIRKQTFMAMLLKLR
QRVLFLLDGYNEFKPQNCPEIEALIKENHRFKNMVIVTTTTECLRHIRQFGALTAEVGDM
TEDSAQALIREVLIKELAEGLLLQIQKSRCLRNLMKTPLFVVITCAIQMGESEFHSHTQT
TLFHTFYDLLIQKNKHKHKGVAASDFIRSLDHCGDLALEGVFSHKFDFELQDVSSVNEDV
LLTTGLLCKYTAQRFKPKYKFFHKSFQEYTAGRRLSSLLTSHEPEEVTKGNGYLQKMVSI
SDITSTYSSLLRYTCGSSVEATRAVMKHLAAVYQHGCLLGLSIAKRPLWRQESLQSVKNT
TEQEILKAININSFVECGIHLYQESTSKSALSQEFEAFFQGKSLYINSGNIPDYLFDFFE
HLPNCASALDFIKLDFYGGAMASWEKAAEDTGGIHMEEAPETYIPSRAVSLFFNWKQEFR
TLEVTLRDFSKLNKQDIRYLGKIFSSATSLRLQIKRCAGVAGSLSLVLSTCKNIYSLMVE
ASPLTIEDERHITSVTNLKTLSIHDLQNQRLPGGLTDSLGNLKNLTKLIMDNIKMNEEDA
IKLAEGLKNLKKMCLFHLTHLSDIGEGMDYIVKSLSSEPCDLEEIQLVSCCLSANAVKIL
AQNLHNLVKLSILDLSENYLEKDGNEALHELIDRMNVLEQLTALMLPWGCDVQGSLSSLL
KHLEEVPQLVKLGLKNWRLTDTEIRILGAFFGKNPLKNFQQLNLAGNRVSSDGWLAFMGV
FENLKQLVFFDFSTKEFLPDPALVRKLSQVLSKLTFLQEARLVGWQFDDDDLSVITGAFK
LVTA
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcataaaggacaatagccgagcccttattcaaagaatgggaatgactgttata
aagcaaatcacagatgacctatttgtatggaatgttctgaatcgcgaagaagtaaacatc
atttgctgcgagaaggtggagcaggatgctgctagagggatcattcacatgattttgaaa
aagggttcagagtcctgtaacctctttcttaaatcccttaaggagtggaactatcctcta
tttcaggacttgaatggacaaagtctttttcatcagacatcagaaggagacttggacgat
ttggctcaggatttaaaggacttgtaccataccccatcttttctgaacttttatcccctt
ggtgaagatattgacattatttttaacttgaaaagcaccttcacagaacctgtcctgtgg
aggaaggaccaacaccatcaccgcgtggagcagctgaccctgaatggcctcctgcaggct
cttcagagcccctgcatcattgaaggggaatctggcaaaggcaagtccactctgctgcag
cgaattgccatgctctggggctccggaaagtgcaaggctctgaccaagttcaaattcgtc
ttcttcctccgtctcagcagggcccagggtggactttttgaaaccctctgtgatcaactc
ctggatatacctggcacaatcaggaagcagacattcatggccatgctgctgaagctgcgg
cagagggttcttttccttcttgatggctacaatgaattcaagccccagaactgcccagaa
atcgaagccctgataaaggaaaaccaccgcttcaagaacatggtcatcgtcaccactacc
actgagtgcctgaggcacatacggcagtttggtgccctgactgctgaggtgggggatatg
acagaagacagcgcccaggctctcatccgagaagtgctgatcaaggagcttgctgaaggc
ttgttgctccaaattcagaaatccaggtgcttgaggaatctcatgaagacccctctcttt
gtggtcatcacttgtgcaatccagatgggtgaaagtgagttccactctcacacacaaaca
acgctgttccataccttctatgatctgttgatacagaaaaacaaacacaaacataaaggt
gtggctgcaagtgacttcattcggagcctggaccactgtggagacctagctctggagggt
gtgttctcccacaagtttgatttcgaactgcaggatgtgtccagcgtgaatgaggatgtc
ctgctgacaactgggctcctctgtaaatatacagctcaaaggttcaagccaaagtataaa
ttctttcacaagtcattccaggagtacacagcaggacgaagactcagcagtttattgacg
tctcatgagccagaggaggtgaccaaggggaatggttacttgcagaaaatggtttccatt
tcggacattacatccacttatagcagcctgctccggtacacctgtgggtcatctgtggaa
gccaccagggctgttatgaagcacctcgcagcagtgtatcaacacggctgccttctcgga
ctttccatcgccaagaggcctctctggagacaggaatctttgcaaagtgtgaaaaacacc
actgagcaagaaattctgaaagccataaacatcaattcctttgtagagtgtggcatccat
ttatatcaagagagtacatccaaatcagccctgagccaagaatttgaagctttctttcaa
ggtaaaagcttatatatcaactcagggaacatccccgattacttatttgacttctttgaa
catttgcccaattgtgcaagtgccctggacttcattaaactggacttttatgggggagct
atggcttcatgggaaaaggctgcagaagacacaggtggaatccacatggaagaggcccca
gaaacctacattcccagcagggctgtatctttgttcttcaactggaagcaggaattcagg
actctggaggtcacactccgggatttcagcaagttgaataagcaagatatcagatatctg
gggaaaatattcagctctgccacaagcctcaggctgcaaataaagagatgtgctggtgtg
gctggaagcctcagtttggtcctcagcacctgtaagaacatttattctctcatggtggaa
gccagtcccctcaccatagaagatgagaggcacatcacatctgtaacaaacctgaaaacc
ttgagtattcatgacctacagaatcaacggctgccgggtggtctgactgacagcttgggt
aacttgaagaaccttacaaagctcataatggataacataaagatgaatgaagaagatgct
ataaaactagctgaaggcctgaaaaacctgaagaagatgtgtttatttcatttgacccac
ttgtctgacattggagagggaatggattacatagtcaagtctctgtcaagtgaaccctgt
gaccttgaagaaattcaattagtctcctgctgcttgtctgcaaatgcagtgaaaatccta
gctcagaatcttcacaatttggtcaaactgagcattcttgatttatcagaaaattacctg
gaaaaagatggaaatgaagctcttcatgaactgatcgacaggatgaacgtgctagaacag
ctcaccgcactgatgctgccctggggctgtgacgtgcaaggcagcctgagcagcctgttg
aaacatttggaggaggtcccacaactcgtcaagcttgggttgaaaaactggagactcaca
gatacagagattagaattttaggtgcattttttggaaagaaccctctgaaaaacttccag
cagttgaatttggcgggaaatcgtgtgagcagtgatggatggcttgccttcatgggtgta
tttgagaatcttaagcaattagtgttttttgactttagtactaaagaatttctacctgat
ccagcattagtcagaaaacttagccaagtgttatccaagttaacttttctgcaagaagct
aggcttgttgggtggcaatttgatgatgatgatctcagtgttattacaggtgcttttaaa
ctagtaactgcttaa

DBGET integrated database retrieval system