KEGG   Homo sapiens (human): 58485
Entry
58485             CDS       T01001                                 

Gene name
TRAPPC1, BET5, MUM2
Definition
(RefSeq) trafficking protein particle complex 1
  KO
K20300  trafficking protein particle complex subunit 1
Organism
hsa  Homo sapiens (human)
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01291  TRAPPI-RAB1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    58485 (TRAPPC1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Tethering complex
   TRAPP complex II
    58485 (TRAPPC1)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   TRAPP complex I
    58485 (TRAPPC1)
SSDB
Motif
Pfam: Sybindin Sedlin_N
Other DBs
NCBI-GeneID: 58485
NCBI-ProteinID: NP_001160093
OMIM: 610969
HGNC: 19894
Ensembl: ENSG00000170043
Vega: OTTHUMG00000108171
Pharos: Q9Y5R8(Tdark)
UniProt: Q9Y5R8
Position
17p13.1
AA seq 145 aa
MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDG
FLAFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQT
VQSELFRSRLDSYVRSLPFFSARAG
NT seq 438 nt   +upstreamnt  +downstreamnt
atgactgtccacaacctgtacctgtttgaccggaatggagtgtgtctgcactacagcgaa
tggcaccgcaagaagcaagcagggattcccaaggaggaggagtataagctgatgtacggg
atgctcttctctatccgctcgtttgtcagcaagatgtccccgctagacatgaaggatggc
ttcctggccttccaaactagccgttacaaactccattactacgagacgcccactgggatc
aaagttgtcatgaatactgacttgggcgtgggacccatccgagatgtgctgcaccacatc
tacagtgcgctgtatgtggagctggtggtgaagaatcccctgtgcccgctgggccaaact
gtgcaaagtgagctctttcgctcccgactggactcctatgttcgctctctgcccttcttc
tccgcccgggctggctga

DBGET integrated database retrieval system