KEGG   Homo sapiens (human): 58491
Entry
58491             CDS       T01001                                 

Gene name
ZNF71, EZFIT
Definition
(RefSeq) zinc finger protein 71
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zf_UBZ Zn-ribbon_8 Zn_ribbon_recom zinc_ribbon_15 XPA_N zf-C2H2_11 DUF3268 C1_4 Zn_ribbon_SprT LIM OSTMP1 zf-BED Zn_Tnp_IS1595 zf-met zf-C2HC_2 BolA
Other DBs
NCBI-GeneID: 58491
NCBI-ProteinID: NP_067039
OMIM: 194545
HGNC: 13141
Ensembl: ENSG00000197951
Vega: OTTHUMG00000182157
Pharos: Q9NQZ8(Tdark)
UniProt: Q9NQZ8
Position
19q13.43
AA seq 489 aa
MKELDPKNDISEDKLSVVGEATGGPTRNGARGPGSEGVWEPGSWPERPRGDAGAEWEPLG
IPQGNKLLGGSVPACHELKAFANQGCVLVPPRLDDPTEKGACPPVRRGKNFSSTSDLSKP
PMPCEEKKTYDCSECGKAFSRSSSLIKHQRIHTGEKPFECDTCGKHFIERSSLTIHQRVH
TGEKPYACGDCGKAFSQRMNLTVHQRTHTGEKPYVCDVCGKAFRKTSSLTQHERIHTGEK
PYACGDCGKAFSQNMHLIVHQRTHTGEKPYVCPECGRAFSQNMHLTEHQRTHTGEKPYAC
KECGKAFNKSSSLTLHQRNHTGEKPYVCGECGKAFSQSSYLIQHQRFHIGVKPFECSECG
KAFSKNSSLTQHQRIHTGEKPYECYICKKHFTGRSSLIVHQIVHTGEKPYVCGECGKAFS
QSAYLIEHQRIHTGEKPYRCGQCGKSFIKNSSLTVHQRIHTGEKPYRCGECGKTFSRNTN
LTRHLRIHT
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgaaagagttggatccaaagaatgacatttcggaagacaagctctccgttgttggggag
gccacggggggacccacgaggaatggtgccaggggtcctggctcagaaggagtgtgggaa
ccaggcagctggccagagaggccgcggggagatgcaggtgcagagtgggagccattggga
attccccaggggaacaaactcttagggggctcagtacccgcatgtcatgaactgaaggca
tttgccaaccaaggctgtgtcctggtcccaccacggctggacgaccccacagaaaagggg
gcctgtccacccgtaaggcgtggcaagaacttctccagcacttcagacctcagtaagccc
cccatgccctgcgaggagaagaaaacctacgactgcagcgagtgtggcaaggcctttagc
cgaagctcgtccctgataaagcaccaaaggatccacacgggagaaaagccgtttgagtgt
gacacctgtgggaagcacttcatcgagcgctcgtccctcaccatccaccagcgggtgcac
acgggcgagaagccctatgcctgcggggactgcggcaaggccttcagccagcgcatgaac
ctcactgtgcaccagcgcacgcacacgggcgagaagccgtatgtgtgcgacgtgtgtggc
aaggccttccggaagacttcctctctcacccagcacgagcggatccacacgggggagaag
ccctacgcgtgcggggactgcggcaaggccttcagccagaacatgcacctcatcgtgcac
cagcgcacgcacaccggggagaagccgtacgtgtgccccgagtgcgggcgagccttcagc
cagaacatgcacctgaccgagcaccagcgcacgcacaccggggagaagccgtacgcctgc
aaggagtgcggcaaggccttcaacaagagctcctcgctcaccctgcaccagaggaaccac
accggcgagaagccctacgtgtgcggcgagtgcggcaaggccttcagccagagctcctac
ctcatccagcaccagcgcttccacatcggcgtgaagccgttcgagtgcagcgagtgcggc
aaggccttcagcaagaactcctcgctcacgcagcaccagcgcatccacaccggcgagaag
ccctacgagtgctacatctgcaagaagcacttcacggggcgctcgtccctcatcgtgcac
cagatcgtgcacaccggggagaagccctacgtgtgcggcgagtgcggcaaggccttcagc
cagagcgcctacctcatcgagcaccagcggatccacaccggcgagaagccgtacaggtgc
ggccagtgcgggaagtccttcatcaagaactcctccctcactgtgcaccagcggatccac
acgggcgagaagccctaccgatgcggcgagtgcgggaagaccttcagccgcaacacgaac
ctgacgcgccacctgcggattcacacctga

DBGET integrated database retrieval system