KEGG   Homo sapiens (human): 58494Help
Entry
58494             CDS       T01001                                 

Gene name
JAM2, C21orf43, CD322, JAM-B, JAMB, PRO245, VE-JAM, VEJAM
Definition
(RefSeq) junctional adhesion molecule 2
  KO
K06735  junctional adhesion molecule 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    58494 (JAM2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    58494 (JAM2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    58494 (JAM2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    58494 (JAM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    58494 (JAM2)
CD molecules [BR:hsa04090]
 Proteins
  58494 (JAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set ig Ig_2 V-set Izumo-Ig C2-set_2 Ig_6 Ig_5 DUF3377
Motif
Other DBs
NCBI-GeneID: 58494
NCBI-ProteinID: NP_067042
OMIM: 606870
HGNC: 14686
Ensembl: ENSG00000154721
Vega: OTTHUMG00000078441
Pharos: P57087(Tbio)
UniProt: P57087
Position
21q21.3
AA seq 298 aa AA seqDB search
MARRSRHRLLLLLLRYLVVALGYHKAYGFSAPKDQQVVTAVEYQEAILACKTPKKTVSSR
LEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQN
LEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPR
LGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISGI
IAAVVVVALVISVCGLGVCYAQRKGYFSKETSFQKSNSSSKATTMSENDFKHTKSFII
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaggagccgccaccgcctcctcctgctgctgctgcgctacctggtggtcgcc
ctgggctatcataaggcctatgggttttctgccccaaaagaccaacaagtagtcacagca
gtagagtaccaagaggctattttagcctgcaaaaccccaaagaagactgtttcctccaga
ttagagtggaagaaactgggtcggagtgtctcctttgtctactatcaacagactcttcaa
ggtgattttaaaaatcgagctgagatgatagatttcaatatccggatcaaaaatgtgaca
agaagtgatgcggggaaatatcgttgtgaagttagtgccccatctgagcaaggccaaaac
ctggaagaggatacagtcactctggaagtattagtggctccagcagttccatcatgtgaa
gtaccctcttctgctctgagtggaactgtggtagagctacgatgtcaagacaaagaaggg
aatccagctcctgaatacacatggtttaaggatggcatccgtttgctagaaaatcccaga
cttggctcccaaagcaccaacagctcatacacaatgaatacaaaaactggaactctgcaa
tttaatactgtttccaaactggacactggagaatattcctgtgaagcccgcaattctgtt
ggatatcgcaggtgtcctgggaaacgaatgcaagtagatgatctcaacataagtggcatc
atagcagccgtagtagttgtggccttagtgatttccgtttgtggccttggtgtatgctat
gctcagaggaaaggctacttttcaaaagaaacctccttccagaagagtaattcttcatct
aaagccacgacaatgagtgaaaatgatttcaagcacacaaaatcctttataatttaa

DBGET integrated database retrieval system