KEGG   Homo sapiens (human): 58494
Entry
58494             CDS       T01001                                 

Symbol
JAM2, C21orf43, CD322, IBGC8, JAM-B, JAMB, PRO245, VE-JAM, VEJAM
Name
(RefSeq) junctional adhesion molecule 2
  KO
K06735  junctional adhesion molecule 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Disease
H01574  Familial idiopathic basal ganglia calcification
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    58494 (JAM2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    58494 (JAM2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    58494 (JAM2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    58494 (JAM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    58494 (JAM2)
CD molecules [BR:hsa04090]
 Proteins
  58494 (JAM2)
SSDB
Motif
Pfam: Ig_3 I-set ig Ig_2 V-set Ig_6 C2-set_2 Izumo-Ig Ig_5 DUF3377
Other DBs
NCBI-GeneID: 58494
NCBI-ProteinID: NP_067042
OMIM: 606870
HGNC: 14686
Ensembl: ENSG00000154721
Vega: OTTHUMG00000078441
Pharos: P57087(Tbio)
UniProt: P57087
Position
21q21.3
AA seq 298 aa
MARRSRHRLLLLLLRYLVVALGYHKAYGFSAPKDQQVVTAVEYQEAILACKTPKKTVSSR
LEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQN
LEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPR
LGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISGI
IAAVVVVALVISVCGLGVCYAQRKGYFSKETSFQKSNSSSKATTMSENDFKHTKSFII
NT seq 897 nt   +upstreamnt  +downstreamnt
atggcgaggaggagccgccaccgcctcctcctgctgctgctgcgctacctggtggtcgcc
ctgggctatcataaggcctatgggttttctgccccaaaagaccaacaagtagtcacagca
gtagagtaccaagaggctattttagcctgcaaaaccccaaagaagactgtttcctccaga
ttagagtggaagaaactgggtcggagtgtctcctttgtctactatcaacagactcttcaa
ggtgattttaaaaatcgagctgagatgatagatttcaatatccggatcaaaaatgtgaca
agaagtgatgcggggaaatatcgttgtgaagttagtgccccatctgagcaaggccaaaac
ctggaagaggatacagtcactctggaagtattagtggctccagcagttccatcatgtgaa
gtaccctcttctgctctgagtggaactgtggtagagctacgatgtcaagacaaagaaggg
aatccagctcctgaatacacatggtttaaggatggcatccgtttgctagaaaatcccaga
cttggctcccaaagcaccaacagctcatacacaatgaatacaaaaactggaactctgcaa
tttaatactgtttccaaactggacactggagaatattcctgtgaagcccgcaattctgtt
ggatatcgcaggtgtcctgggaaacgaatgcaagtagatgatctcaacataagtggcatc
atagcagccgtagtagttgtggccttagtgatttccgtttgtggccttggtgtatgctat
gctcagaggaaaggctacttttcaaaagaaacctccttccagaagagtaattcttcatct
aaagccacgacaatgagtgaaaatgatttcaagcacacaaaatcctttataatttaa

DBGET integrated database retrieval system